SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g16073

Feature Type:gene_model
Chromosome:Gm10
Start:18979189
stop:18980683
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g16073
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34480AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L18ae/LX family protein | chr2:14532916-14534161 REVERSE LENGTH=178 SoyBaseE_val: 5.00E-18ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR10052Panther 60S RIBOSOMAL PROTEIN L18A JGI ISS
PTHR10052:SF1Panther 60S RIBOSOMAL PROTEIN L18A JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
PF01775PFAM Ribosomal L18ae/LX protein domain JGI ISS
UniRef100_G7JA80UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycine-rich RNA-binding protein n=1 Tax=Medicago truncatula RepID=G7JA80_MEDTR SoyBaseE_val: 3.00E-22ISS
UniRef100_UPI000233C238UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C238 related cluster n=1 Tax=unknown RepID=UPI000233C238 SoyBaseE_val: 4.00E-80ISS

Expression Patterns of Glyma10g16073
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g16073 not represented in the dataset
Glyma10g16073 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g16073 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g106200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g16073
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g16073
>Glyma10g16073.1   sequence type=CDS   gene model=Glyma10g16073   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACCAGATCAGCACCCTAAGATCTACCGAATGAAGCTCTGGTCCATCAATAAGGTTCGCGCCAAGTCCAAGTTCTGGTATTTTCTGAGGAAATTGAAAAAGGTGAAGAAGAGCAATGACCAAGTGTTTATTATCAACAAGGATTTTTGTAATAAGGTTGGAAATGTCTTGAGGCAAAGTGTTGCTTTCAGCACAAAAGCACTTGTTTCATCCATGCTTAATTACATTCGCTGCATGTTTTCAAGCAAGCTTTTCATTGGAGGCCTTTCATATGGAGTTGATGATCAGTCTCTTAAGGATGTATTTTCTGACTTTGGAGATATGGTTGATAGTAAATTTGGCTCACTTTCATTGCTGTTACATGGTTTGTTGATGAGATCTTCCATGATTTAA
Predicted protein sequences of Glyma10g16073
>Glyma10g16073.1   sequence type=predicted peptide   gene model=Glyma10g16073   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEPDQHPKIYRMKLWSINKVRAKSKFWYFLRKLKKVKKSNDQVFIINKDFCNKVGNVLRQSVAFSTKALVSSMLNYIRCMFSSKLFIGGLSYGVDDQSLKDVFSDFGDMVDSKFGSLSLLLHGLLMRSSMI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo