Glyma10g16010 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g16010

Feature Type:	gene_model
Chromosome:	Gm10
Start:	18873321
stop:	18874699
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g16010

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G05840	AT	Annotation by Michelle Graham. TAIR10: 20S proteasome subunit PAA2 \| chr2:2234226-2235973 FORWARD LENGTH=220	SoyBase	E_val: 3.00E-41	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0051603	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005839	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex	SoyBase	N/A	ISS
GO:0019773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex, alpha-subunit complex	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0004175	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity	SoyBase	N/A	ISS
GO:0004298	GO-mf	Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0008233	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidase activity	SoyBase	N/A	ISS
PTHR11599	Panther	PROTEASOME SUBUNIT ALPHA/BETA	JGI		ISS
PTHR11599:SF11	Panther	PROTEASOME BETA/DELTA SUBUNIT	JGI		ISS
PF00227	PFAM	Proteasome subunit	JGI		ISS
UniRef100_I1LA45	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LA45_SOYBN	SoyBase	E_val: 2.00E-102	ISS
UniRef100_I1LSZ7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit alpha type n=2 Tax=Glycine max RepID=I1LSZ7_SOYBN	SoyBase	E_val: 6.00E-42	ISS

Expression Patterns of Glyma10g16010

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g16010 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g16010

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g16010

Limit To All Plant Sequences

>Glyma10g16010.1   sequence type=CDS   gene model=Glyma10g16010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGCTTTCAAGGCTGTTAAGGCCACTGAAATCACCTCAATTGGTAAGAAGGTTCCGGATAAGCTTTTGGACAACACAAGTGTTACACACCTCTTTCCCATCACCAAGTACCTTGGTTTATTGGCTACTGGCATGACAGCTGATGCTAGGGCATTGGTCCAACAAGCAACAAATGAAGCAACTGAGTTTCGCTTTACATATGGATATGAAATGCCAGTAGATGTATTAGCTAAATGGTTTATATATAAAGCTGAAGAGAAAACTTGGGTAGAGACAAGTGATCATAATATCAAACCTCTATGTGATTTATATTTATTGATAGTATATATTCAGGTCCAAAACCAAAACCACCTTATTATTGAAACTATTTTTAACAGAAAAATAGTGGTGCAAATAGTAATAATATTCGATGTGATTGAAATGAAATTGATTAACAAAATC

Predicted protein sequences of Glyma10g16010

Limit To All Plant Sequences

>Glyma10g16010.1   sequence type=predicted peptide   gene model=Glyma10g16010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YAFKAVKATEITSIGKKVPDKLLDNTSVTHLFPITKYLGLLATGMTADARALVQQATNEATEFRFTYGYEMPVDVLAKWFIYKAEEKTWVETSDHNIKPLCDLYLLIVYIQVQNQNHLIIETIFNRKIVVQIVIIFDVIEMKLINKI

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain