SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g16010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g16010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g16010

Feature Type:gene_model
Chromosome:Gm10
Start:18873321
stop:18874699
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g16010
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G05840AT Annotation by Michelle Graham. TAIR10: 20S proteasome subunit PAA2 | chr2:2234226-2235973 FORWARD LENGTH=220 SoyBaseE_val: 3.00E-41ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0051603GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005839GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex SoyBaseN/AISS
GO:0019773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex, alpha-subunit complex SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0004175GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity SoyBaseN/AISS
GO:0004298GO-mf Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
PTHR11599Panther PROTEASOME SUBUNIT ALPHA/BETA JGI ISS
PTHR11599:SF11Panther PROTEASOME BETA/DELTA SUBUNIT JGI ISS
PF00227PFAM Proteasome subunit JGI ISS
UniRef100_I1LA45UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LA45_SOYBN SoyBaseE_val: 2.00E-102ISS
UniRef100_I1LSZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit alpha type n=2 Tax=Glycine max RepID=I1LSZ7_SOYBN SoyBaseE_val: 6.00E-42ISS

Expression Patterns of Glyma10g16010
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g16010 not represented in the dataset
Glyma10g16010 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g16010 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g16010
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g16010
>Glyma10g16010.1   sequence type=CDS   gene model=Glyma10g16010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGCTTTCAAGGCTGTTAAGGCCACTGAAATCACCTCAATTGGTAAGAAGGTTCCGGATAAGCTTTTGGACAACACAAGTGTTACACACCTCTTTCCCATCACCAAGTACCTTGGTTTATTGGCTACTGGCATGACAGCTGATGCTAGGGCATTGGTCCAACAAGCAACAAATGAAGCAACTGAGTTTCGCTTTACATATGGATATGAAATGCCAGTAGATGTATTAGCTAAATGGTTTATATATAAAGCTGAAGAGAAAACTTGGGTAGAGACAAGTGATCATAATATCAAACCTCTATGTGATTTATATTTATTGATAGTATATATTCAGGTCCAAAACCAAAACCACCTTATTATTGAAACTATTTTTAACAGAAAAATAGTGGTGCAAATAGTAATAATATTCGATGTGATTGAAATGAAATTGATTAACAAAATC
Predicted protein sequences of Glyma10g16010
>Glyma10g16010.1   sequence type=predicted peptide   gene model=Glyma10g16010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YAFKAVKATEITSIGKKVPDKLLDNTSVTHLFPITKYLGLLATGMTADARALVQQATNEATEFRFTYGYEMPVDVLAKWFIYKAEEKTWVETSDHNIKPLCDLYLLIVYIQVQNQNHLIIETIFNRKIVVQIVIIFDVIEMKLINKI






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo