SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g15770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g15770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g15770

Feature Type:gene_model
Chromosome:Gm10
Start:18336843
stop:18340652
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33950AT Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr4:16272819-16274657 FORWARD LENGTH=314 SoyBaseE_val: 7.00E-86ISS
GO:0005985GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose metabolic process SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010118GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal movement SoyBaseN/AISS
GO:0010119GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement SoyBaseN/AISS
GO:0019432GO-bp Annotation by Michelle Graham. GO Biological Process: triglyceride biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:2000377GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of reactive oxygen species metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0009931GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-dependent protein serine/threonine kinase activity SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24343Panther SERINE/THREONINE KINASE JGI ISS
PTHR24343:SF58Panther SUBFAMILY NOT NAMED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_G7LGB9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase SAPK3 n=1 Tax=Medicago truncatula RepID=G7LGB9_MEDTR SoyBaseE_val: 3.00E-86ISS
UniRef100_UPI000233C22EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C22E related cluster n=1 Tax=unknown RepID=UPI000233C22E SoyBaseE_val: 2.00E-93ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g15770 not represented in the dataset

Glyma10g15770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g15770.1   sequence type=CDS   gene model=Glyma10g15770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTCACAAAAGAAATAGCGAAACAAGGATTTTTTTTGGGTATTCTAAATCATAGTTTTGATTCAACAATTGATGAAAATGTCAAAAGAGAAATAATTAATCATAGGTCTCTAAGACATCCTAACATTATCAAGTTTAAGGAGGTCATTTTAACACCTACTCATCTGGCCATTGTAATGGAATATGCATCTGGTGGAGAACTATTTGAGAAAATCTGCAATGCAGGACATTTTAATGAGGGTGAGGCTCGTTTCTTTTTTCACCAACTCATATCGGGGGTCAGCTATTGTCATGCAATGGAAGTGTGTCACCGGGACCTGAAGTTGGAAAACACTTTGTTGGATGGAAGCTTGACACTTCATTTTAATATATGTGATTTTGGATACTCCAAGTTTGTGCTTGATCCATTCATTAGAATTGGGCCTATCCCAAGTCCAAGTGATAGAGTGCTAGACCAGAATATTGCAGATGTCTGGTCATGTGGAGTAACCTTGTTTGTGATGCTAGTGGGATCATATCCTTTTGAAGATCCTAATGATCCAAAGGATTTCCGAAAGACAATTCAGAAAAGTGATCAACATCACTTATCAACTATG

>Glyma10g15770.1   sequence type=predicted peptide   gene model=Glyma10g15770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FTKEIAKQGFFLGILNHSFDSTIDENVKREIINHRSLRHPNIIKFKEVILTPTHLAIVMEYASGGELFEKICNAGHFNEGEARFFFHQLISGVSYCHAMEVCHRDLKLENTLLDGSLTLHFNICDFGYSKFVLDPFIRIGPIPSPSDRVLDQNIADVWSCGVTLFVMLVGSYPFEDPNDPKDFRKTIQKSDQHHLSTM







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo