Glyma10g15637 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g15637

Feature Type:	gene_model
Chromosome:	Gm10
Start:	18130007
stop:	18131387
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g15637

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G53830	AT	Annotation by Michelle Graham. TAIR10: VQ motif-containing protein \| chr5:21857057-21857788 FORWARD LENGTH=243	SoyBase	E_val: 4.00E-18	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_D7MTK6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: VQ motif-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MTK6_ARALL	SoyBase	E_val: 5.00E-16	ISS
UniRef100_I1M371	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M371_SOYBN	SoyBase	E_val: 1.00E-41	ISS

Expression Patterns of Glyma10g15637

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g15637 not represented in the dataset	Glyma10g15637 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g15637 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g15637

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g15637

Limit To All Plant Sequences

>Glyma10g15637.1   sequence type=CDS   gene model=Glyma10g15637   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGATGATGCGGGAGTTGTCGCGGAGGTCAATTTGCGGCGAGTGGAAGGGGTCACCGTTATCGGAGAGCAAGGAGGAAGGAAAGGCTTTGTATACCCCACCAAAGCAGCAACAAGGCTTCAAGCTCTACGACAGGAGGAACAACACCCTCAAGAACAGCCTTATGCTCAACACCTTGATGCCCAATTTTGCTCACAATCACAACAACAACAACTCTCCAAGCTTCTCATCAAGTAACATTCCTGAGATCCTCTCCCCAGGCCTTCTTGACTTCCCTTCCCTTGCTCTTAGCCCTGTCACACAATTTAATGATGACCCATTTGACAAGTCCTCTCCTTCATTGGGGAACTCATCAGAGGAGGATAAACCCATAGCTGAAAGGGCTTCTACTTGCATCCCTCTCCCATCTTTAATCCAAGAGACTCAGAACCATAGCTCTTGCCTCTTTTCCCAGTTACTCACCTAG

Predicted protein sequences of Glyma10g15637

Limit To All Plant Sequences

>Glyma10g15637.1   sequence type=predicted peptide   gene model=Glyma10g15637   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTMMRELSRRSICGEWKGSPLSESKEEGKALYTPPKQQQGFKLYDRRNNTLKNSLMLNTLMPNFAHNHNNNNSPSFSSSNIPEILSPGLLDFPSLALSPVTQFNDDPFDKSSPSLGNSSEEDKPIAERASTCIPLPSLIQETQNHSSCLFSQLLT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain