Glyma10g15532 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g15532

Feature Type:	gene_model
Chromosome:	Gm10
Start:	17965608
stop:	17967148
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g15532

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G11820	AT	Annotation by Michelle Graham. TAIR10: hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl coenzyme A synthase \| chr4:7109124-7111213 REVERSE LENGTH=406	SoyBase	E_val: 3.00E-19	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0008299	GO-bp	Annotation by Michelle Graham. GO Biological Process: isoprenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019287	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate pathway	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004421	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydroxymethylglutaryl-CoA synthase activity	SoyBase	N/A	ISS
PTHR11877	Panther	HYDROXYMETHYLGLUTARYL-COA SYNTHASE	JGI		ISS
PTHR11877:SF10	Panther	HMG-COA SYNTHASE	JGI		ISS
PF01154	PFAM	Hydroxymethylglutaryl-coenzyme A synthase N terminal	JGI		ISS
UniRef100_A9LRT6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 3-hydroxy-3-methylglutaryl coenzyme A synthase n=1 Tax=Solanum lycopersicum RepID=A9LRT6_SOLLC	SoyBase	E_val: 2.00E-18	ISS
UniRef100_I1L3F8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L3F8_SOYBN	SoyBase	E_val: 7.00E-20	ISS

Expression Patterns of Glyma10g15532

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g15532 not represented in the dataset	Glyma10g15532 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g15532 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g108800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g15532

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g15532

Limit To All Plant Sequences

>Glyma10g15532.1   sequence type=CDS   gene model=Glyma10g15532   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTATTTGTGTTTATGTGATATCTGTATCTTATATTAATAACTCATGCAACAATCAAGCAAGTGGTAATATTGATATTGAAGATGTTGATTCAACTAATGCATGCTATGGAGGAACAACTACTTTGTTCAAGTGTGTGAATTGGGTGAATAGTAGCTCATGGGATGGAGATTATGGACTTATTATATGTACAAACATTATGGTATGTTTGCGACAGATTTACTACTTAATGCATAAGGAAATTTCAATTCTTATATTTTATCCATTTTTTTAA

Predicted protein sequences of Glyma10g15532

Limit To All Plant Sequences

>Glyma10g15532.1   sequence type=predicted peptide   gene model=Glyma10g15532   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCICVYVISVSYINNSCNNQASGNIDIEDVDSTNACYGGTTTLFKCVNWVNSSSWDGDYGLIICTNIMVCLRQIYYLMHKEISILIFYPFF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain