SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g15280

Feature Type:gene_model
Chromosome:Gm10
Start:17775764
stop:17777659
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g15280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04040AT Annotation by Michelle Graham. TAIR10: HAD superfamily, subfamily IIIB acid phosphatase | chr1:1042564-1043819 REVERSE LENGTH=271 SoyBaseE_val: 3.00E-92ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003993GO-mf Annotation by Michelle Graham. GO Molecular Function: acid phosphatase activity SoyBaseN/AISS
PTHR11726Panther 60S RIBOSOMAL PROTEIN L10 JGI ISS
PTHR11726:SF1Panther 50S RIBOSOMAL PROTEIN L10E JGI ISS
PF03767PFAM HAD superfamily, subfamily IIIB (Acid phosphatase) JGI ISS
UniRef100_G7I6M3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Stem 28 kDa glycoprotein n=1 Tax=Medicago truncatula RepID=G7I6M3_MEDTR SoyBaseE_val: 5.00E-156ISS
UniRef100_I1LA27UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LA27_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma10g15280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g15280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.U041700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g15280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g15280
>Glyma10g15280.1   sequence type=CDS   gene model=Glyma10g15280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAAACACTTTGGTTCTTTTTGGTTTTCACATGCCTTTTGATTCCTCTAGCAGTTGCAGATTGGAACATACTGAAGCTGCAGACACAAGATGGATTGAAGATCAGCCTGAAGAACTATTGTGAAAGCTGGAGGATGAATGTGGAGCTGCACAACATTAGGGACTTCCAAGTTGTGCCTGAAGAGTGCACTGAATACATTGGAAAATATGTTAAGTCCACACAGTACAAAGTAGACTCACAGAGGGCATCTGAAGAGTGCTTGGTTTACCTTAGCACCAGCTGTAATTTGAAGAAAGATGGATTGGATGCTTGGATTTTTGACATTGATGATACCCTGCTTTCAACTGTTCCTTACTACAAGAATAATCTATATGGGGGAAAGAAACTGAATGTGACATCTCTAGAGGAATGGATGCGCAAAGGCAATGCACCTGCTCTTGATCACTCATTGAACCTATACAATGAACTTAAATCCAGGGGTGTGCAAATCATTATGGTTACTTCAAGGAAGGAGCATCTCAGATCAGCCACAATTGACAACCTTGTCAAAGTTGGTTATTATGGGTGGACTAAAATTGTCTTTAGAGATCCTGCTAATGAATTGGTGTCAGTGCAAAAGTACAAGTCTGATGTGAGAAGGCAAATAATAAATGAGGGTTATCGCATTTGGGGCATTGTTGGGGACCAATACAGTAGCATTGAGGGGATTCCAAACCCCAGAAGGGCATTTAAACTCCCAAATCCAATGTACTATGTTGCCTAA
Predicted protein sequences of Glyma10g15280
>Glyma10g15280.1   sequence type=predicted peptide   gene model=Glyma10g15280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKTLWFFLVFTCLLIPLAVADWNILKLQTQDGLKISLKNYCESWRMNVELHNIRDFQVVPEECTEYIGKYVKSTQYKVDSQRASEECLVYLSTSCNLKKDGLDAWIFDIDDTLLSTVPYYKNNLYGGKKLNVTSLEEWMRKGNAPALDHSLNLYNELKSRGVQIIMVTSRKEHLRSATIDNLVKVGYYGWTKIVFRDPANELVSVQKYKSDVRRQIINEGYRIWGIVGDQYSSIEGIPNPRRAFKLPNPMYYVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo