SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g15062

Feature Type:gene_model
Chromosome:Gm10
Start:17508632
stop:17510290
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g15062
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G36160AT Annotation by Michelle Graham. TAIR10: acetyl-CoA carboxylase 1 | chr1:13534196-13543773 FORWARD LENGTH=2254 SoyBaseE_val: 2.00E-53ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009631GO-bp Annotation by Michelle Graham. GO Biological Process: cold acclimation SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0030497GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid elongation SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003989GO-mf Annotation by Michelle Graham. GO Molecular Function: acetyl-CoA carboxylase activity SoyBaseN/AISS
GO:0004075GO-mf Annotation by Michelle Graham. GO Molecular Function: biotin carboxylase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016874GO-mf Annotation by Michelle Graham. GO Molecular Function: ligase activity SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR25871Panther FAMILY NOT NAMED JGI ISS
PTHR25871:SF6Panther SUBFAMILY NOT NAMED JGI ISS
PF00364PFAM Biotin-requiring enzyme JGI ISS
PF08326PFAM Acetyl-CoA carboxylase, central region JGI ISS
UniRef100_Q39849UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acetyl-CoA carboxylase (Fragment) n=1 Tax=Glycine max RepID=Q39849_SOYBN SoyBaseE_val: 2.00E-56ISS
UniRef100_UPI0002338528UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338528 related cluster n=1 Tax=unknown RepID=UPI0002338528 SoyBaseE_val: 5.00E-63ISS

Expression Patterns of Glyma10g15062
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g15062 not represented in the dataset
Glyma10g15062 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g15062 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g109600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g15062
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma10g15062
>Glyma10g15062.2   sequence type=transcript   gene model=Glyma10g15062   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCCATCTCTGTGTGGCTATATGATAGTCATGTTGATGCTGACACACCGTATGCTGAAGTTGAGGTCATGAAAATGTGCATGCCTCTTCTTTCGCTTGCATCTGGGATTATTCATTTCAAAATGTCTGAAGGTCAAGCAATGCAGGCTGGTGAACTTATAGCAAGGCTTCATCTGGATGATCCTTCAGCTATAAGAAAGGCAGAACCCTTCACTGGGAGCTTCCCAGTTCTGGGACATCCTACTGCAATTTCTGGTAAAGTTCATCATAAATGCGTTGCAAGCTTAAATGTTGCACGGATGATTCTTTCTGGGTATGACCACAATATTGATGAAGTGAGTAAATTCTTCACCTTGATTCATTAACATTGATGAGGGTGGAAGAGAGAGCCATGCCCATATAATTGTTCAATTCCTATTTGATGAGTATCTTTCTGTTGAAGAATTATTTAGCGATAATATTCAGGTTATTATGATTATTCAACTGCTTGTACTAATATTATGTGGGTAAATCTGTTATGACCTTTTATGATTT
Coding sequences of Glyma10g15062
>Glyma10g15062.1   sequence type=CDS   gene model=Glyma10g15062   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCCATCTCTGTGTGGCTATATGATAGTCATGTTGATGCTGACACACCGTATGCTGAAGTTGAGGTCATGAAAATGTGCATGCCTCTTCTTTCGCTTGCATCTGGGATTATTCATTTCAAAATGTCTGAAGGTCAAGCAATGCAGGCTGGTGAACTTATAGCAAGGCTTCATCTGGATGATCCTTCAGCTATAAGAAAGGCAGAACCCTTCACTGGGAGCTTCCCAGTTCTGGGACATCCTACTGCAATTTCTGGTAAAGTTCATCATAAATGCGTTGCAAGCTTAAATGTTGCACGGATGATTCTTTCTGGGTATGACCACAATATTGATGAAGTGAGTAAATTCTTCACCTTGATTCATTAA

>Glyma10g15062.2   sequence type=CDS   gene model=Glyma10g15062   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCCATCTCTGTGTGGCTATATGATAGTCATGTTGATGCTGACACACCGTATGCTGAAGTTGAGGTCATGAAAATGTGCATGCCTCTTCTTTCGCTTGCATCTGGGATTATTCATTTCAAAATGTCTGAAGGTCAAGCAATGCAGGCTGGTGAACTTATAGCAAGGCTTCATCTGGATGATCCTTCAGCTATAAGAAAGGCAGAACCCTTCACTGGGAGCTTCCCAGTTCTGGGACATCCTACTGCAATTTCTGGTAAAGTTCATCATAAATGCGTTGCAAGCTTAAATGTTGCACGGATGATTCTTTCTGGGTATGACCACAATATTGATGAAGTGAGTAAATTCTTCACCTTGATTCATTAA
Predicted protein sequences of Glyma10g15062
>Glyma10g15062.1   sequence type=predicted peptide   gene model=Glyma10g15062   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPISVWLYDSHVDADTPYAEVEVMKMCMPLLSLASGIIHFKMSEGQAMQAGELIARLHLDDPSAIRKAEPFTGSFPVLGHPTAISGKVHHKCVASLNVARMILSGYDHNIDEVSKFFTLIH*

>Glyma10g15062.2   sequence type=predicted peptide   gene model=Glyma10g15062   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPISVWLYDSHVDADTPYAEVEVMKMCMPLLSLASGIIHFKMSEGQAMQAGELIARLHLDDPSAIRKAEPFTGSFPVLGHPTAISGKVHHKCVASLNVARMILSGYDHNIDEVSKFFTLIH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo