SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g14964

Feature Type:gene_model
Chromosome:Gm10
Start:17401920
stop:17402684
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g14964
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26360AT Annotation by Michelle Graham. TAIR10: TCP-1/cpn60 chaperonin family protein | chr5:9255561-9258891 REVERSE LENGTH=555 SoyBaseE_val: 9.00E-37ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0044267GO-bp Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
PTHR11353Panther CHAPERONIN JGI ISS
PF00118PFAM TCP-1/cpn60 chaperonin family JGI ISS
UniRef100_B7FLQ5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FLQ5_MEDTR SoyBaseE_val: 1.00E-37ISS
UniRef100_G7IPS8UniRef Annotation by Michelle Graham. Most informative UniRef hit: T-complex protein 1 subunit gamma (Fragment) n=1 Tax=Medicago truncatula RepID=G7IPS8_MEDTR SoyBaseE_val: 2.00E-35ISS

Expression Patterns of Glyma10g14964
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g14964 not represented in the dataset
Glyma10g14964 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g14964 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g109800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g14964
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g14964
>Glyma10g14964.1   sequence type=CDS   gene model=Glyma10g14964   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGATGTCTATCAGGCTGTTGCTGATATAATTCGTACAACCTTGGGACCCAGGTCCAAGTTAAAAATGCTACTTGATGCTTCAGGAGGCATTGTGGTGACAAATGATGGAAATGCTATCTTGCGTGAAATAGATCTTGCTCATCCTGATGCAAAGTCTATGGTTGAATTGAGTCGCACCCAAGATGAAGAAGTTGGAGATGGAACAACGTCTATCATCATTCTTAGTATGTTTTGA
Predicted protein sequences of Glyma10g14964
>Glyma10g14964.1   sequence type=predicted peptide   gene model=Glyma10g14964   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIDVYQAVADIIRTTLGPRSKLKMLLDASGGIVVTNDGNAILREIDLAHPDAKSMVELSRTQDEEVGDGTTSIIILSMF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo