SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g14932

Feature Type:gene_model
Chromosome:Gm10
Start:17313062
stop:17314138
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g14932
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G59090AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1084 (InterPro:IPR009457); BEST Arabidopsis thaliana protein match is: tobamovirus multiplication 1 (TAIR:AT4G21790.1); Has 198 Blast hits to 197 proteins in 29 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 2; Plants - 190; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink). | chr3:21839334-21842449 FORWARD LENGTH=373 SoyBaseE_val: 5.00E-14ISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
UniRef100_Q945Q2UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g59090/F17J16_140 n=1 Tax=Arabidopsis thaliana RepID=Q945Q2_ARATH SoyBaseE_val: 2.00E-11ISS
UniRef100_UPI000233C223UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C223 related cluster n=1 Tax=unknown RepID=UPI000233C223 SoyBaseE_val: 1.00E-63ISS

Expression Patterns of Glyma10g14932
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g14932 not represented in the dataset
Glyma10g14932 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g14932 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g14932
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g14932
>Glyma10g14932.1   sequence type=CDS   gene model=Glyma10g14932   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGAACTGCTGAAAAATGTTTTGCAGCTTTCCCCAAAGGTTGACCTTTGCCATCAGGCATATGATGATGATGACTATGAAGGAAGTTTTTGTGACAACCCTTTGCTGGAGAACACTTCAAATGAATCAAATTTAGCAAGCATAGATAGCCATAGAAAGTGCTTTCCTTTTTGGTTTGCTCGTGTTGGAAATCGGCAAAAGATTGTGATTTTGGTTACTTTGCTAGTTTTCATCATCGTGGTTGCTTTTGCTGTAGTAATCTGGATTGGGCTAGGAAAGAATCCCATTGATTCTGAAGTGGCAGCTCAGGTATGGGACAGTAATTTTAGTTTTGGTTTATAA
Predicted protein sequences of Glyma10g14932
>Glyma10g14932.1   sequence type=predicted peptide   gene model=Glyma10g14932   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSELLKNVLQLSPKVDLCHQAYDDDDYEGSFCDNPLLENTSNESNLASIDSHRKCFPFWFARVGNRQKIVILVTLLVFIIVVAFAVVIWIGLGKNPIDSEVAAQVWDSNFSFGL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo