Glyma10g14870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g14870

Feature Type:	gene_model
Chromosome:	Gm10
Start:	17267261
stop:	17269391
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g14870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G55850	AT	Annotation by Michelle Graham. TAIR10: RPM1-interacting protein 4 (RIN4) family protein \| chr5:22603617-22604951 FORWARD LENGTH=114	SoyBase	E_val: 4.00E-26	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05627	PFAM	Cleavage site for pathogenic type III effector avirulence factor Avr	JGI		ISS
UniRef100_B9S9V8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NOI, putative n=1 Tax=Ricinus communis RepID=B9S9V8_RICCO	SoyBase	E_val: 3.00E-24	ISS
UniRef100_I1MWB4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MWB4_SOYBN	SoyBase	E_val: 2.00E-41	ISS

Expression Patterns of Glyma10g14870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g14870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g110600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g14870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g14870

Limit To All Plant Sequences

>Glyma10g14870.1   sequence type=CDS   gene model=Glyma10g14870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGGAAAAGGGCCGCCCACTTCCAAAATTTGGTGAATGGGATGTCAATGATCCAACCTCAGCTGAGGGGTTCACAGTGATTTTTAATAAGGCCAGGGATGAGAAAAAGACAGGTGGCAACCCAGATTCACCAGGAAAGACTGCCACTGATCCTCATAGCAAACCAGCAGTAGAGCCTGGCAAAACTCAAACTGTAAGATGTTCTTGA

Predicted protein sequences of Glyma10g14870

Limit To All Plant Sequences

>Glyma10g14870.1   sequence type=predicted peptide   gene model=Glyma10g14870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSEKGRPLPKFGEWDVNDPTSAEGFTVIFNKARDEKKTGGNPDSPGKTATDPHSKPAVEPGKTQTVRCS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain