SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g14741

Feature Type:gene_model
Chromosome:Gm10
Start:16985924
stop:16986567
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g14741
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G25120AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr4:12890694-12898309 FORWARD LENGTH=1149 SoyBaseE_val: 2.00E-26ISS
GO:0006310GO-bp Annotation by Michelle Graham. GO Biological Process: DNA recombination SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0032204GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0036292GO-bp Annotation by Michelle Graham. GO Biological Process: DNA rewinding SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043247GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003678GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA helicase activity SoyBaseN/AISS
GO:0004003GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent DNA helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR11070Panther UVRD / RECB / PCRA DNA HELICASE FAMILY MEMBER JGI ISS
PF00580PFAM UvrD/REP helicase JGI ISS
UniRef100_D9IV51UniRef Annotation by Michelle Graham. Most informative UniRef hit: UvrD helicase n=1 Tax=Hordeum vulgare subsp. vulgare RepID=D9IV51_HORVD SoyBaseE_val: 6.00E-28ISS
UniRef100_UPI000233DC1FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DC1F related cluster n=1 Tax=unknown RepID=UPI000233DC1F SoyBaseE_val: 2.00E-33ISS

Expression Patterns of Glyma10g14741
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g14741 not represented in the dataset
Glyma10g14741 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g14741 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g14741
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g14741
>Glyma10g14741.1   sequence type=CDS   gene model=Glyma10g14741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGGGCGTGTATTGATGCTGCTCAATGAGGGCATTAGTCCATCAAACATTCTTGCAATGACATTTACTACAGCAGCTGCTTCTGAAATGAGAGAACGTATAGAAGCTATAGTTGGGAAGGCAACAGCTAAAGAACTTACTATCAGTACTTTTCATTCATTTTCCTTGCAGCTTTGTCGTTCACATGGAGAAAAGTATGTTGCTCTGAATTTGAATCAGATTTTCACTTTAATTTGTCCTCAATCTGCTGATTAA
Predicted protein sequences of Glyma10g14741
>Glyma10g14741.1   sequence type=predicted peptide   gene model=Glyma10g14741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGRVLMLLNEGISPSNILAMTFTTAAASEMRERIEAIVGKATAKELTISTFHSFSLQLCRSHGEKYVALNLNQIFTLICPQSAD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo