SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g14701

Feature Type:gene_model
Chromosome:Gm10
Start:16974088
stop:16976390
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g14701
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G04540AT Annotation by Michelle Graham. TAIR10: Beta-ketoacyl synthase | chr2:1581521-1584635 REVERSE LENGTH=461 SoyBaseE_val: 2.00E-45ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004312GO-mf Annotation by Michelle Graham. GO Molecular Function: fatty acid synthase activity SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PTHR11712Panther POLYKETIDE SYNTHASE-RELATED JGI ISS
PTHR11712:SF23Panther gb def: 3-oxoacyl-(acyl-carrier-protein) synthase ii [bacillus halodurans] JGI ISS
PF02801PFAM Beta-ketoacyl synthase, C-terminal domain JGI ISS
UniRef100_I1L8I1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 3-oxoacyl-[acyl-carrier-protein] synthase n=1 Tax=Glycine max RepID=I1L8I1_SOYBN SoyBaseE_val: 4.00E-56ISS
UniRef100_I1LA08UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LA08_SOYBN SoyBaseE_val: 4.00E-89ISS

Expression Patterns of Glyma10g14701
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g14701 not represented in the dataset
Glyma10g14701 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g14701 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g14701
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g14701
>Glyma10g14701.1   sequence type=CDS   gene model=Glyma10g14701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGGTGATGCATATCATATTACTCAACCTCCTAGTGATGGGAGAGGAGCCATTTTGGCCATGACTCGTGCTTTAAGACAGTGGACCTTTGGACAAGTGAAGTGGACCTTTACTGATTCCAGCAATTTAAGCTTGAATATTATTATTTTTGAATATTTCATCTCTGCGAGTTTGTGCTATTGCGATGCAATAGAAGCTAATGCTATCAAAACCATGTTCTCTGACCGTGCAAGCTTGTCTGCTTTAGCCCTCTCCTCCACAAAGGGTGCTATTGGTCATCTCCTAGGCGCTGCTGGAGCTGTTGAAGCAATTTTTGCAGTTTTGGCAATACGGCATGATATTGCTCCATTAACTCTTAATTTAATTAAGCCAGATCTTGTGTTTGGTGATGGTTTCATGCCATTGTCCGCTTTAGAAGAAATGCCAATTAGAGTTGTTATGTCACAAAAATTTGAACCTTCCCAAGTAAAGTGTTTCTTTCCACAAAAGTGCTGA
Predicted protein sequences of Glyma10g14701
>Glyma10g14701.1   sequence type=predicted peptide   gene model=Glyma10g14701   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGDAYHITQPPSDGRGAILAMTRALRQWTFGQVKWTFTDSSNLSLNIIIFEYFISASLCYCDAIEANAIKTMFSDRASLSALALSSTKGAIGHLLGAAGAVEAIFAVLAIRHDIAPLTLNLIKPDLVFGDGFMPLSALEEMPIRVVMSQKFEPSQVKCFFPQKC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo