Glyma10g14620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g14620

Feature Type:	gene_model
Chromosome:	Gm10
Start:	16817083
stop:	16817679
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Expression Patterns of Glyma10g14620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g14620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g111300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g14620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g14620

Limit To All Plant Sequences

>Glyma10g14620.1   sequence type=CDS   gene model=Glyma10g14620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTACGACCGCCTCATCGAGTCCAACCACAAGTCAAATACGCCTTAGCCCCAAATCGAACCCAAACCCTTCGTGTTCTCGTCTTGCTCCGCATGCACCGCCGCGACACTTACTCCACCTGTGCCATCACAGGTCTCGCGGAGGAAGGCTTGGGGGAGGTTGTTGTTCTTTGGTCATTTTTGGATAG

Predicted protein sequences of Glyma10g14620

Limit To All Plant Sequences

>Glyma10g14620.1   sequence type=predicted peptide   gene model=Glyma10g14620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLTTASSSPTTSQIRLSPKSNPNPSCSRLAPHAPPRHLLHLCHHRSRGGRLGGGCCSLVIFG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain