SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g14110

Feature Type:gene_model
Chromosome:Gm10
Start:16201885
stop:16205828
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g14110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G56240AT Annotation by Michelle Graham. TAIR10: copper chaperone | chr3:20863460-20864402 REVERSE LENGTH=121 SoyBaseE_val: 4.00E-35ISS
GO:0000302GO-bp Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species SoyBaseN/AISS
GO:0006598GO-bp Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006878GO-bp Annotation by Michelle Graham. GO Biological Process: cellular copper ion homeostasis SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0009805GO-bp Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0016531GO-mf Annotation by Michelle Graham. GO Molecular Function: copper chaperone activity SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
KOG1603 KOG Copper chaperone JGI ISS
PTHR22814Panther COPPER TRANSPORT PROTEIN ATOX1-RELATED JGI ISS
PF00403PFAM Heavy-metal-associated domain JGI ISS
UniRef100_C6SVX9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVX9_SOYBN SoyBaseE_val: 2.00E-86ISS
UniRef100_Q9SE03UniRef Annotation by Michelle Graham. Most informative UniRef hit: Copper chaperone homolog CCH n=1 Tax=Glycine max RepID=Q9SE03_SOYBN SoyBaseE_val: 2.00E-60ISS

Expression Patterns of Glyma10g14110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g14110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g112000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g14110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g14110
>Glyma10g14110.1   sequence type=CDS   gene model=Glyma10g14110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCTCAGACCGTTGTCCTCAAAGTTGGTATGTCATGTCAAGGGTGTGCTGGAGCTGTAAACAGGGTTTTGGAAAAAATGGAAGGTGTTGAGTCATTTGACATTGATCTGAAGGAGCAGAAGGTGACAGTGAAAGGAAATGTGCAGCCGGACGAAGTTCTGCAAGCCGTTTCCAAATCCGGAAAGAAGACGGCATTCTGGGTGGATGAAGCACAACCACCTGAAAACAAGCCTTCTGAAACTGCACCTGTTACCTCAGCTGAGAATGATAACAAGGCTTCAGAAAGTGGACCTGTTGCCTCAGAAAACAAGCCTCCAGAAGCTGCACATGTTGCCTCAGCTGACCCTGAAACCAAGCCTTCAGAAACTGCTGTTGAAACTGTTGCTTAA
Predicted protein sequences of Glyma10g14110
>Glyma10g14110.1   sequence type=predicted peptide   gene model=Glyma10g14110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSQTVVLKVGMSCQGCAGAVNRVLEKMEGVESFDIDLKEQKVTVKGNVQPDEVLQAVSKSGKKTAFWVDEAQPPENKPSETAPVTSAENDNKASESGPVASENKPPEAAHVASADPETKPSETAVETVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo