|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G56240 | AT | Annotation by Michelle Graham. TAIR10: copper chaperone | chr3:20863460-20864402 REVERSE LENGTH=121 | SoyBase | E_val: 4.00E-35 | ISS |
| GO:0000302 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species | SoyBase | N/A | ISS |
| GO:0006598 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0006816 | GO-bp | Annotation by Michelle Graham. GO Biological Process: calcium ion transport | SoyBase | N/A | ISS |
| GO:0006878 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular copper ion homeostasis | SoyBase | N/A | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0007568 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aging | SoyBase | N/A | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009698 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process | SoyBase | N/A | ISS |
| GO:0009805 | GO-bp | Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process | SoyBase | N/A | ISS |
| GO:0009963 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0030001 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metal ion transport | SoyBase | N/A | ISS |
| GO:0042398 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0016531 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper chaperone activity | SoyBase | N/A | ISS |
| GO:0046872 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: metal ion binding | SoyBase | N/A | ISS |
| KOG1603 | KOG | Copper chaperone | JGI | ISS | |
| PTHR22814 | Panther | COPPER TRANSPORT PROTEIN ATOX1-RELATED | JGI | ISS | |
| PF00403 | PFAM | Heavy-metal-associated domain | JGI | ISS | |
| UniRef100_C6SVX9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVX9_SOYBN | SoyBase | E_val: 2.00E-86 | ISS |
| UniRef100_Q9SE03 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Copper chaperone homolog CCH n=1 Tax=Glycine max RepID=Q9SE03_SOYBN | SoyBase | E_val: 2.00E-60 | ISS |
|
Glyma10g14110 not represented in the dataset |
Glyma10g14110 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.10g112000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma10g14110.1 sequence type=CDS gene model=Glyma10g14110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCTTCTCAGACCGTTGTCCTCAAAGTTGGTATGTCATGTCAAGGGTGTGCTGGAGCTGTAAACAGGGTTTTGGAAAAAATGGAAGGTGTTGAGTCATTTGACATTGATCTGAAGGAGCAGAAGGTGACAGTGAAAGGAAATGTGCAGCCGGACGAAGTTCTGCAAGCCGTTTCCAAATCCGGAAAGAAGACGGCATTCTGGGTGGATGAAGCACAACCACCTGAAAACAAGCCTTCTGAAACTGCACCTGTTACCTCAGCTGAGAATGATAACAAGGCTTCAGAAAGTGGACCTGTTGCCTCAGAAAACAAGCCTCCAGAAGCTGCACATGTTGCCTCAGCTGACCCTGAAACCAAGCCTTCAGAAACTGCTGTTGAAACTGTTGCTTAA
>Glyma10g14110.1 sequence type=predicted peptide gene model=Glyma10g14110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSSQTVVLKVGMSCQGCAGAVNRVLEKMEGVESFDIDLKEQKVTVKGNVQPDEVLQAVSKSGKKTAFWVDEAQPPENKPSETAPVTSAENDNKASESGPVASENKPPEAAHVASADPETKPSETAVETVA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||