SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g13820

Feature Type:gene_model
Chromosome:Gm10
Start:15674159
stop:15675061
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g13820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63310AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G20362.1); Has 78 Blast hits to 77 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 78; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:23486580-23487044 REVERSE LENGTH=154 SoyBaseE_val: 2.00E-26ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q01HX1UniRef Annotation by Michelle Graham. Most informative UniRef hit: B0616E02-H0507E05.1 protein n=2 Tax=Oryza sativa RepID=Q01HX1_ORYSA SoyBaseE_val: 4.00E-09ISS
UniRef100_UPI00023371A7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023371A7 related cluster n=1 Tax=unknown RepID=UPI00023371A7 SoyBaseE_val: 5.00E-122ISS

Expression Patterns of Glyma10g13820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g13820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g112800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g13820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g13820
>Glyma10g13820.1   sequence type=CDS   gene model=Glyma10g13820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTCACCAGTGCAGCCAAGTCACTCTCCATCATCTGCTGAAGGTGAGAAACATGCACGCAAGCAATTGGATAGAGAGATTAGGGACATGGTCTCTGCCATCACTGACAGGGTCACAGATTTTCACAAACCAGGCTCAACCAACCATATGGAGAATGATGGTGAACATGGTTTGAGCATGGTCACCCTTGTAGGAAACAACAACGGCGCCACTATGAAAAGTGAATTCGACGAAAAATCAGGCAACCCTTCTCATGGTGATGAGCCTGAGGCACTGAGCACCTATGTTAACAGCAACTTCCAAGCCATCAACAACTCAGTCATGCTTGGTGGAAGTTACCAGACCAATGATCCAGGTGTGCACATGGATATCTCAGATTTCTCCACTGAGCATGAGCAGCACCATCGAAGTCACTACCAGAAGGAAGAAAAGCATGGGAAGAAGGGAAAGAAAATAGAGAAAAAAGCTTCCAAATCCAGACATCTTTCATCATCATCATCAGAAGATTCTGATTGA
Predicted protein sequences of Glyma10g13820
>Glyma10g13820.1   sequence type=predicted peptide   gene model=Glyma10g13820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSPVQPSHSPSSAEGEKHARKQLDREIRDMVSAITDRVTDFHKPGSTNHMENDGEHGLSMVTLVGNNNGATMKSEFDEKSGNPSHGDEPEALSTYVNSNFQAINNSVMLGGSYQTNDPGVHMDISDFSTEHEQHHRSHYQKEEKHGKKGKKIEKKASKSRHLSSSSSEDSD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo