SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g13771

Feature Type:gene_model
Chromosome:Gm10
Start:15530487
stop:15530999
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g13771
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G13440AT Annotation by Michelle Graham. TAIR10: glucose-inhibited division family A protein | chr2:5593270-5598296 REVERSE LENGTH=723 SoyBaseE_val: 4.00E-49ISS
GO:0002098GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA wobble uridine modification SoyBaseN/AISS
GO:0008033GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA processing SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
PTHR11806Panther GLUCOSE INHIBITED DIVISION PROTEIN A JGI ISS
PF01134PFAM Glucose inhibited division protein A JGI ISS
UniRef100_G7LE56UniRef Annotation by Michelle Graham. Most informative UniRef hit: tRNA uridine 5-carboxymethylaminomethyl modification enzyme mnmG n=1 Tax=Medicago truncatula RepID=G7LE56_MEDTR SoyBaseE_val: 1.00E-51ISS
UniRef100_UPI000233A279UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A279 related cluster n=1 Tax=unknown RepID=UPI000233A279 SoyBaseE_val: 5.00E-53ISS

Expression Patterns of Glyma10g13771
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g13771 not represented in the dataset
Glyma10g13771 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g13771 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g114000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g13771
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g13771
>Glyma10g13771.1   sequence type=CDS   gene model=Glyma10g13771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGGTAGGGGAGGGTAGCAATTTGAACTCCAGCACTCCAAACCTTTCTATTCGAGAGGCTATGGTCACAAATATTTTACTAGGGAAGAATGATAACGTGGAAGGTGTTTGTACATTCTTTGGAATGAAATTCTATGCTCCGTCTGTTATTCTCACCACAGGGACTTTTATGAGTGGTAAAATTTGGGTCGGTAGAACTTCTATGCCTGCAGGAAGAGTTGGCGAGTCTGCTTCACTTGGATTAACAAAAAACTTACAACGACTTGGTTTTGAAACTGATCGGTTGAAAAATGGAACCCCTGCCTGA
Predicted protein sequences of Glyma10g13771
>Glyma10g13771.1   sequence type=predicted peptide   gene model=Glyma10g13771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLVGEGSNLNSSTPNLSIREAMVTNILLGKNDNVEGVCTFFGMKFYAPSVILTTGTFMSGKIWVGRTSMPAGRVGESASLGLTKNLQRLGFETDRLKNGTPA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo