SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g13720

Feature Type:gene_model
Chromosome:Gm10
Start:15478720
stop:15479844
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g13720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31800AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 18 | chr4:15383296-15384812 FORWARD LENGTH=310 SoyBaseE_val: 9.00E-18ISS
GO:0002237GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0050691GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response to virus by host SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_B9TMN2UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor, putative (Fragment) n=1 Tax=Ricinus communis RepID=B9TMN2_RICCO SoyBaseE_val: 3.00E-17ISS
UniRef100_I1L9Z3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9Z3_SOYBN SoyBaseE_val: 2.00E-83ISS

Proteins Associated with Glyma10g13720
LocusGene SymbolProtein Name
WRKY128 WRKY Transcription Factor

Expression Patterns of Glyma10g13720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g13720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g113800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g13720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g13720
>Glyma10g13720.1   sequence type=CDS   gene model=Glyma10g13720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCATCACAGATTTTTATGTGTAAAATTAATTTACTTGGTCCCATTACTCAATCAATAGCATTACTAACTGAGTATGTGAGGGACAGATATCAGTGGAGAAAATATGGTAAAAAAGTCACCAGAGATAACCCTTCTCCTAGGGCTTACTTCAAGTGTTCATATGCCCCAAGCTGCCCAGTGAACAAGTTTGATTTATATGACCTTTTTCCGCGGATCATGTTAATCACTGACTCTGTAATGAGTCATTTAAGTCAAGTGCAGTCGCAGATTGAGCAACCTATTTTATCACCTCTAATAATAAATATGGGTAAGATCGCTTGTTGGGGAGGAGGATGTTTCATATTAGGAACCAAAATTTGA
Predicted protein sequences of Glyma10g13720
>Glyma10g13720.1   sequence type=predicted peptide   gene model=Glyma10g13720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSQIFMCKINLLGPITQSIALLTEYVRDRYQWRKYGKKVTRDNPSPRAYFKCSYAPSCPVNKFDLYDLFPRIMLITDSVMSHLSQVQSQIEQPILSPLIINMGKIACWGGGCFILGTKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo