Report for Sequence Feature Glyma10g13720
Feature Type: gene_model
Chromosome: Gm10
Start: 15478720
stop: 15479844
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g13720
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G31800 AT
Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 18 | chr4:15383296-15384812 FORWARD LENGTH=310
SoyBase E_val: 9.00E-18 ISS
GO:0002237 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin
SoyBase N/A ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009751 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0031347 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of defense response
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0050691 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of defense response to virus by host
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0042802 GO-mf
Annotation by Michelle Graham. GO Molecular Function: identical protein binding
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
PF03106 PFAM
WRKY DNA -binding domain
JGI ISS
UniRef100_B9TMN2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor, putative (Fragment) n=1 Tax=Ricinus communis RepID=B9TMN2_RICCO
SoyBase E_val: 3.00E-17 ISS
UniRef100_I1L9Z3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9Z3_SOYBN
SoyBase E_val: 2.00E-83 ISS
Proteins Associated with Glyma10g13720
Locus Gene Symbol Protein Name
WRKY128 WRKY Transcription Factor
Expression Patterns of Glyma10g13720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma10g13720 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g113800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g13720
Coding sequences of Glyma10g13720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g13720.1 sequence type=CDS gene model=Glyma10g13720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCCATCACAGATTTTTATGTGTAAAATTAATTTACTTGGTCCCATTACTCAATCAATAGCATTACTAACTGAGTATGTGAGGGACAGATATCAGTGGAGAAAATATGGTAAAAAAGTCACCAGAGATAACCCTTCTCCTAGGGCTTACTTCAAGTGTTCATATGCCCCAAGCTGCCCAGTGAACAAGTTTGATTTATATGACCTTTTTCCGCGGATCATGTTAATCACTGACTCTGTAATGAGTCATTTAAGTCAAGTGCAGTCGCAGATTGAGCAACCTATTTTATCACCTCTAATAATAAATATGGGTAAGATCGCTTGTTGGGGAGGAGGATGTTTCATATTAGGAACCAAAATTTGA
Predicted protein sequences of Glyma10g13720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g13720.1 sequence type=predicted peptide gene model=Glyma10g13720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MPSQIFMCKINLLGPITQSIALLTEYVRDRYQWRKYGKKVTRDNPSPRAYFKCSYAPSCPVNKFDLYDLFPRIMLITDSVMSHLSQVQSQIEQPILSPLIINMGKIACWGGGCFILGTKI*