SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g13710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g13710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g13710

Feature Type:gene_model
Chromosome:Gm10
Start:15475456
stop:15477253
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G21090AT Annotation by Michelle Graham. TAIR10: ABC-2 type transporter family protein | chr3:7391497-7394933 REVERSE LENGTH=691 SoyBaseE_val: 7.00E-84ISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
GO:0042626GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances SoyBaseN/AISS
PTHR19241Panther ATP-BINDING CASSETTE TRANSPORTER JGI ISS
PTHR19241:SF20Panther ABC TRANSPORTER JGI ISS
PF01061PFAM ABC-2 type transporter JGI ISS
UniRef100_G7I6I8UniRef Annotation by Michelle Graham. Most informative UniRef hit: ABC transporter G family member n=1 Tax=Medicago truncatula RepID=G7I6I8_MEDTR SoyBaseE_val: 1.00E-93ISS
UniRef100_I1LIK4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LIK4_SOYBN SoyBaseE_val: 5.00E-98ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g13710 not represented in the dataset

Glyma10g13710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g13710.1   sequence type=CDS   gene model=Glyma10g13710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CACACCTCAAAAACCACAAAAAGCTCCGACATTGTGCCTGATCTTCAGAACACTATGTACGCTTTCATCGACGGTTATCCTTGCGATGTTCCAAATTCACCAGATCCTTTCATGAATTTGGCTACAGCACAGATTAAGGCAACACTAGTTGAGAAATATAGGCGTTCAACATATGCCACAAGGGCAAAGAACAGAATTCAAGAACTGTCTATTGATGGCTTCAACCTCCAACACAACATGGAAGTCAAGCTAAGATGTGGGTTACTACTGGTGAGGATCATAACTTATATCATTGTATCCATATGTTTGGGAACCGTTTATTTTGATGTTGGCTATAGCTACACTTCCATCCTGCCCCTAGATGCCTACGGTGCATTTATATCAGGATTTATGACATTCAAAAATGAAGAAAGGCTTAATGGATACTATGGAGTAGCAGCATATATTTTAGCCAACTTCCTTTCTTCATTCCCATTCTTGGTTCTAATTGCTCTGACATCCTGCACCATTATGTATAACATGGTGAAATTCAGGCCAGGAATCAATCACTTTGTGTTTTTCTTTCTCAACATCTACAGCTGCATCTCCGTAATAGAGAGCCTCATGATTGTTGTAGCTTCACTTGTTCCAAATTTCCTCATGGGAATAATTACAGGGGCTGGAATAATAGGAATCATGATGATGACCTCCGGATTCTTCACGTTGCTCTCTGATCTTCCAAAGCCAGTTTGGCGCTACCCATATTTATATATCAGTTATGGTTCTTGCCTTCTTGGGCAATACAGG

>Glyma10g13710.1   sequence type=predicted peptide   gene model=Glyma10g13710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
HTSKTTKSSDIVPDLQNTMYAFIDGYPCDVPNSPDPFMNLATAQIKATLVEKYRRSTYATRAKNRIQELSIDGFNLQHNMEVKLRCGLLLVRIITYIIVSICLGTVYFDVGYSYTSILPLDAYGAFISGFMTFKNEERLNGYYGVAAYILANFLSSFPFLVLIALTSCTIMYNMVKFRPGINHFVFFFLNIYSCISVIESLMIVVASLVPNFLMGIITGAGIIGIMMMTSGFFTLLSDLPKPVWRYPYLYISYGSCLLGQYR







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo