Report for Sequence Feature Glyma10g13700
Feature Type: gene_model
Chromosome: Gm10
Start: 15462470
stop: 15463510
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g13700
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G32090 AT
Annotation by Michelle Graham. TAIR10: Beta-1,3-N-Acetylglucosaminyltransferase family protein | chr4:15509990-15510820 REVERSE LENGTH=124
SoyBase E_val: 4.00E-32 ISS
GO:0006486 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein glycosylation
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0008378 GO-mf
Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity
SoyBase N/A ISS
PTHR11214 Panther
BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE
JGI ISS
PTHR11214:SF61 Panther
GALACTOSYLTRANSFERASE
JGI ISS
UniRef100_C6T437 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T437_SOYBN
SoyBase E_val: 1.00E-84 ISS
UniRef100_D7MAS1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Galactosyltransferase n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MAS1_ARALL
SoyBase E_val: 8.00E-30 ISS
Expression Patterns of Glyma10g13700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma10g13700 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g113700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g13700
Coding sequences of Glyma10g13700
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g13700.1 sequence type=CDS gene model=Glyma10g13700 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAACAACCTTCAAGTACTTTACTTCCATCCTCTTCCTCACCCTCGTCATCAAAGGGTCATGTGATGACTGTTCCTTGAACAACATCAATATTGGCACATCAAGAACTGGGAGAGAAATCCAGGGCCAGCCTGAGTGGAACGTGACCGTGATCAACAATTGCAACTGTGAACAGAGTCAGATAAAGTTGTCTTGCAAAGGTTTTCAAAGTGCAGAAAGTGTTGACCCTTCAATTCTTTCCATGGAAGGTGATAGCTGCTTACTCATCAATGGGAATCCAATGAAGGGTTCTGATACTGTTAACTTCTCCTATGCCTGGGATCCTCCCTTTCTGCTTTTGCCTACAAGCTCTGTTTTAGGTCCTTGTTCATAG
Predicted protein sequences of Glyma10g13700
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g13700.1 sequence type=predicted peptide gene model=Glyma10g13700 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATTFKYFTSILFLTLVIKGSCDDCSLNNINIGTSRTGREIQGQPEWNVTVINNCNCEQSQIKLSCKGFQSAESVDPSILSMEGDSCLLINGNPMKGSDTVNFSYAWDPPFLLLPTSSVLGPCS*