SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g13340

Feature Type:gene_model
Chromosome:Gm10
Start:14965884
stop:14968265
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g13340
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34640AT Annotation by Michelle Graham. TAIR10: plastid transcriptionally active 12 | chr2:14582061-14584345 REVERSE LENGTH=527 SoyBaseE_val: 6.00E-12ISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009295GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleoid SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009508GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid chromosome SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G8Z259UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hop-interacting protein THI030 n=1 Tax=Solanum lycopersicum RepID=G8Z259_SOLLC SoyBaseE_val: 1.00E-15ISS
UniRef100_I1M1J3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M1J3_SOYBN SoyBaseE_val: 4.00E-37ISS

Expression Patterns of Glyma10g13340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g13340 not represented in the dataset
Glyma10g13340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g13340 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g13340
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g13340
>Glyma10g13340.1   sequence type=CDS   gene model=Glyma10g13340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTCTTATCTGAAGGAGAAAGGAAAACTTATTTCAAGGGAGGAATTTGACAACATTATGGCCAAGGAAAAGACTGAACAAATTGAGTCGACGGAGATGGATGAAGCTAGGGCCAAAGCTGTTGACATTGGAGAAAATGATGATGAAGAGGATAGTGATGTTGACAGAGAGGAAGAGGGAGAAGAAGAGAAGCTTAGTGATTATTGGAGTGTGTTGAAAAGTACTCCTGAGCTTCACCAGTCAAAGGTATTCTTGTAA
Predicted protein sequences of Glyma10g13340
>Glyma10g13340.1   sequence type=predicted peptide   gene model=Glyma10g13340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSYLKEKGKLISREEFDNIMAKEKTEQIESTEMDEARAKAVDIGENDDEEDSDVDREEEGEEEKLSDYWSVLKSTPELHQSKVFL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo