Report for Sequence Feature Glyma10g12940
Feature Type: gene_model
Chromosome: Gm10
Start: 14611122
stop: 14611836
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g12940
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G32090 AT
Annotation by Michelle Graham. TAIR10: Beta-1,3-N-Acetylglucosaminyltransferase family protein | chr4:15509990-15510820 REVERSE LENGTH=124
SoyBase E_val: 2.00E-29 ISS
GO:0006486 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein glycosylation
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0008378 GO-mf
Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity
SoyBase N/A ISS
PTHR11214 Panther
BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE
JGI ISS
PTHR11214:SF61 Panther
GALACTOSYLTRANSFERASE
JGI ISS
UniRef100_I1L9Y5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9Y5_SOYBN
SoyBase E_val: 9.00E-81 ISS
UniRef100_O49383 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Beta-1,3-N-Acetylglucosaminyltransferase family protein n=1 Tax=Arabidopsis thaliana RepID=O49383_ARATH
SoyBase E_val: 1.00E-26 ISS
Expression Patterns of Glyma10g12940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma10g12940 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g114100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g12940
Coding sequences of Glyma10g12940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g12940.1 sequence type=CDS gene model=Glyma10g12940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGCAACCTTCAAGTACCTTTTTCCCATCCTCTTCCTTACCCTTATAGTCAAAGGGTCTTGTGAGTGTTCCATAAACAACATCAATATTGGCACTACAAGAAGTGGGAGAGTAATACAAGGCCAACCTGAGTGGAACGTAGTTGTGATCAACAACTGCACTTGTACACAAAGCCAGATAAGGTTGTCTTGCAAAGGGTTTAAGACTTCAGAGAGTGTTAGCCCATCAATTCTTTCCATAGAAGGTGACAGCTGCCTCCTTATCAATGGCAATCCTTTGAATAGTTTTGCTACTGTTCGCTTCTCCTATGCTTGGGATCCTCCTTTCCTCTTATTGCCTACAAGCTCTAGTATAAGTTGTTAA
Predicted protein sequences of Glyma10g12940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g12940.1 sequence type=predicted peptide gene model=Glyma10g12940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAATFKYLFPILFLTLIVKGSCECSINNINIGTTRSGRVIQGQPEWNVVVINNCTCTQSQIRLSCKGFKTSESVSPSILSIEGDSCLLINGNPLNSFATVRFSYAWDPPFLLLPTSSSISC*