SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g12940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g12940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g12940

Feature Type:gene_model
Chromosome:Gm10
Start:14611122
stop:14611836
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32090AT Annotation by Michelle Graham. TAIR10: Beta-1,3-N-Acetylglucosaminyltransferase family protein | chr4:15509990-15510820 REVERSE LENGTH=124 SoyBaseE_val: 2.00E-29ISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008378GO-mf Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity SoyBaseN/AISS
PTHR11214Panther BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE JGI ISS
PTHR11214:SF61Panther GALACTOSYLTRANSFERASE JGI ISS
UniRef100_I1L9Y5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9Y5_SOYBN SoyBaseE_val: 9.00E-81ISS
UniRef100_O49383UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-1,3-N-Acetylglucosaminyltransferase family protein n=1 Tax=Arabidopsis thaliana RepID=O49383_ARATH SoyBaseE_val: 1.00E-26ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g12940 not represented in the dataset

Glyma10g12940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g114100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g12940.1   sequence type=CDS   gene model=Glyma10g12940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCAACCTTCAAGTACCTTTTTCCCATCCTCTTCCTTACCCTTATAGTCAAAGGGTCTTGTGAGTGTTCCATAAACAACATCAATATTGGCACTACAAGAAGTGGGAGAGTAATACAAGGCCAACCTGAGTGGAACGTAGTTGTGATCAACAACTGCACTTGTACACAAAGCCAGATAAGGTTGTCTTGCAAAGGGTTTAAGACTTCAGAGAGTGTTAGCCCATCAATTCTTTCCATAGAAGGTGACAGCTGCCTCCTTATCAATGGCAATCCTTTGAATAGTTTTGCTACTGTTCGCTTCTCCTATGCTTGGGATCCTCCTTTCCTCTTATTGCCTACAAGCTCTAGTATAAGTTGTTAA

>Glyma10g12940.1   sequence type=predicted peptide   gene model=Glyma10g12940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATFKYLFPILFLTLIVKGSCECSINNINIGTTRSGRVIQGQPEWNVVVINNCTCTQSQIRLSCKGFKTSESVSPSILSIEGDSCLLINGNPLNSFATVRFSYAWDPPFLLLPTSSSISC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo