|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G10200 | AT | Annotation by Michelle Graham. TAIR10: GATA type zinc finger transcription factor family protein | chr1:3346677-3347763 REVERSE LENGTH=190 | SoyBase | E_val: 6.00E-21 | ISS |
| GO:0051017 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin filament bundle assembly | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0015629 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0051015 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: actin filament binding | SoyBase | N/A | ISS |
| PF00412 | PFAM | LIM domain | JGI | ISS | |
| UniRef100_B9RB75 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Pollen-specific protein SF3, putative n=1 Tax=Ricinus communis RepID=B9RB75_RICCO | SoyBase | E_val: 5.00E-22 | ISS |
| UniRef100_I1JX42 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JX42_SOYBN | SoyBase | E_val: 8.00E-24 | ISS |
|
Glyma10g12890 not represented in the dataset |
Glyma10g12890 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.10g114300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma10g12890.1 sequence type=CDS gene model=Glyma10g12890 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGTCATTTGCAGGGACTACTCAGAAGTGCAAAGCATGTGAGAAGGCTGTGTATTTGGTGGATCAGCTCACTGCTGACAACAAGATCTATCACAAATCATGTTTCAGATGCTACCACTGCAAGGGTACCCTTAAGAATACACCAAGAGCAAGCTCAAGTGCATGA
>Glyma10g12890.1 sequence type=predicted peptide gene model=Glyma10g12890 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASFAGTTQKCKACEKAVYLVDQLTADNKIYHKSCFRCYHCKGTLKNTPRASSSA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||