SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g12890

Feature Type:gene_model
Chromosome:Gm10
Start:14564024
stop:14564226
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10200AT Annotation by Michelle Graham. TAIR10: GATA type zinc finger transcription factor family protein | chr1:3346677-3347763 REVERSE LENGTH=190 SoyBaseE_val: 6.00E-21ISS
GO:0051017GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament bundle assembly SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0015629GO-cc Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0051015GO-mf Annotation by Michelle Graham. GO Molecular Function: actin filament binding SoyBaseN/AISS
PF00412PFAM LIM domain JGI ISS
UniRef100_B9RB75UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pollen-specific protein SF3, putative n=1 Tax=Ricinus communis RepID=B9RB75_RICCO SoyBaseE_val: 5.00E-22ISS
UniRef100_I1JX42UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JX42_SOYBN SoyBaseE_val: 8.00E-24ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g114300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g12890.1   sequence type=CDS   gene model=Glyma10g12890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCATTTGCAGGGACTACTCAGAAGTGCAAAGCATGTGAGAAGGCTGTGTATTTGGTGGATCAGCTCACTGCTGACAACAAGATCTATCACAAATCATGTTTCAGATGCTACCACTGCAAGGGTACCCTTAAGAATACACCAAGAGCAAGCTCAAGTGCATGA

>Glyma10g12890.1   sequence type=predicted peptide   gene model=Glyma10g12890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASFAGTTQKCKACEKAVYLVDQLTADNKIYHKSCFRCYHCKGTLKNTPRASSSA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo