|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G11530 | AT | Annotation by Michelle Graham. TAIR10: C-terminal cysteine residue is changed to a serine 1 | chr1:3874518-3875311 FORWARD LENGTH=118 | SoyBase | E_val: 3.00E-42 | ISS |
| GO:0006661 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process | SoyBase | N/A | ISS |
| GO:0006662 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process | SoyBase | N/A | ISS |
| GO:0045454 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0003756 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| GO:0015035 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity | SoyBase | N/A | ISS |
| KOG0907 | KOG | Thioredoxin | JGI | ISS | |
| PTHR10438 | Panther | THIOREDOXIN-RELATED | JGI | ISS | |
| PTHR10438:SF12 | Panther | THIOREDOXIN | JGI | ISS | |
| PF00085 | PFAM | Thioredoxin | JGI | ISS | |
| UniRef100_I1KEE9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1KEE9_SOYBN | SoyBase | E_val: 4.00E-83 | ISS |
| UniRef100_I1KEE9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1KEE9_SOYBN | SoyBase | E_val: 4.00E-83 | ISS |
|
Glyma10g12850 not represented in the dataset |
Glyma10g12850 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.10g114400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma10g12850.2 sequence type=CDS gene model=Glyma10g12850 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAGGTCAACAACAACTAAAAAACTCTAAGGTGGTGAAAATTGACTCAAGAAAACCATGGGAACACCACATAACTAATGCAACCAATAAAGGCTACCCTGTTATGATTCATTTCTCTGCTTATTGGTGCATGCCTTCAATAGTTATGAATCATTTCTTTCAACAACTGGCCTCCACCTATCATAATGTTCTCTTTCTGAATGTTGATGTTGATGAGGTCAAGGAAGTTGCTTCCAAGTTGAAAATTAAAGCAATTCCTACCTTTTGTTTGATGAATGGAGGAGCTCCAATGGATAAAATTGTGGGTGCAAACCCTGATGAATTAAGGAAAAGGATCAGTTGTTTTATTCACCATAAACATTCACCCAAGTCAGTGTGA
>Glyma10g12850.2 sequence type=predicted peptide gene model=Glyma10g12850 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKGQQQLKNSKVVKIDSRKPWEHHITNATNKGYPVMIHFSAYWCMPSIVMNHFFQQLASTYHNVLFLNVDVDEVKEVASKLKIKAIPTFCLMNGGAPMDKIVGANPDELRKRISCFIHHKHSPKSV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||