SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g12850

Feature Type:gene_model
Chromosome:Gm10
Start:14513280
stop:14514866
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g12850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11530AT Annotation by Michelle Graham. TAIR10: C-terminal cysteine residue is changed to a serine 1 | chr1:3874518-3875311 FORWARD LENGTH=118 SoyBaseE_val: 3.00E-42ISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003756GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
KOG0907 KOG Thioredoxin JGI ISS
PTHR10438Panther THIOREDOXIN-RELATED JGI ISS
PTHR10438:SF12Panther THIOREDOXIN JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_I1KEE9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1KEE9_SOYBN SoyBaseE_val: 4.00E-83ISS
UniRef100_I1KEE9UniRef Annotation by Michelle Graham. Best UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1KEE9_SOYBN SoyBaseE_val: 4.00E-83ISS

Expression Patterns of Glyma10g12850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g12850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g114400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g12850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g12850
>Glyma10g12850.2   sequence type=CDS   gene model=Glyma10g12850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGGTCAACAACAACTAAAAAACTCTAAGGTGGTGAAAATTGACTCAAGAAAACCATGGGAACACCACATAACTAATGCAACCAATAAAGGCTACCCTGTTATGATTCATTTCTCTGCTTATTGGTGCATGCCTTCAATAGTTATGAATCATTTCTTTCAACAACTGGCCTCCACCTATCATAATGTTCTCTTTCTGAATGTTGATGTTGATGAGGTCAAGGAAGTTGCTTCCAAGTTGAAAATTAAAGCAATTCCTACCTTTTGTTTGATGAATGGAGGAGCTCCAATGGATAAAATTGTGGGTGCAAACCCTGATGAATTAAGGAAAAGGATCAGTTGTTTTATTCACCATAAACATTCACCCAAGTCAGTGTGA
Predicted protein sequences of Glyma10g12850
>Glyma10g12850.2   sequence type=predicted peptide   gene model=Glyma10g12850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKGQQQLKNSKVVKIDSRKPWEHHITNATNKGYPVMIHFSAYWCMPSIVMNHFFQQLASTYHNVLFLNVDVDEVKEVASKLKIKAIPTFCLMNGGAPMDKIVGANPDELRKRISCFIHHKHSPKSV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo