Glyma10g12760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g12760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g12760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g12760

Feature Type:	gene_model
Chromosome:	Gm10
Start:	14289218
stop:	14289859
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g12760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G56030	AT	Annotation by Michelle Graham. TAIR10: heat shock protein 81-2 \| chr5:22686923-22689433 FORWARD LENGTH=699	SoyBase	E_val: 7.00E-103	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009612	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009816	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction	SoyBase	N/A	ISS
GO:0009908	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower development	SoyBase	N/A	ISS
GO:0010187	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination	SoyBase	N/A	ISS
GO:0010286	GO-bp	Annotation by Michelle Graham. GO Biological Process: heat acclimation	SoyBase	N/A	ISS
GO:0019722	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling	SoyBase	N/A	ISS
GO:0048366	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf development	SoyBase	N/A	ISS
GO:0050821	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein stabilization	SoyBase	N/A	ISS
GO:0090332	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal closure	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0051082	GO-mf	Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding	SoyBase	N/A	ISS
PTHR11528	Panther	HEAT SHOCK PROTEIN 90	JGI		ISS
PF00183	PFAM	Hsp90 protein	JGI		ISS
UniRef100_G7IDZ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein n=1 Tax=Medicago truncatula RepID=G7IDZ4_MEDTR	SoyBase	E_val: 3.00E-109	ISS
UniRef100_UPI000233D80D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D80D related cluster n=1 Tax=unknown RepID=UPI000233D80D	SoyBase	E_val: 6.00E-153	ISS

Expression Patterns of Glyma10g12760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g12760 not represented in the dataset	Glyma10g12760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g12760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g12760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g12760

Limit To All Plant Sequences

>Glyma10g12760.1   sequence type=CDS   gene model=Glyma10g12760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGCCCATTGTTACAACCAAACACAATGATGATGAACAATATGTTTGGGAGTCTGATGCTGGAGGTTCTTTCACTGTCACCAGGGATAACACTGGTGAGGTTCTTGGAAGGGGTACTAAGATCACTCTCTACCTCAAGGAAGATCAGCTTGAGTACCTTGAGGAGCGTCGCTTGAAGGATTTGATCAAGAAGCATTCTGAGTTCATTAGCTACCCAATTTTTCTTTGGATTGAGAAAACTACCGAGAAGGAGATCTCTGATGATGAGGAGGGTAAGGTGGAGGATGTTGACGAAGAGAAGGAGAAGGAAGAAAAAAAGAAAAAGAAGATTAAGGAAGTGTCACATGAATGCTCCTTGGTGAACAAGCACAAGCCCATTTGGATGAGAAAGCATGAGGAGATCACAAAGGAGGAGTATTCTGCTTTCTACAAGAGTCTCACCAATGACTGGGAAGAGCATTTGGCTGTCAAGCCCTTCTCAGGTGAGGGACAGTTGGAGTTTAAGGCTATCGTCTTTGTTCCTAAGAGGGCACCTTTTGACCTCTTTGACACAAGGAAGAAGCCTAACAATATTAAGCTTTATGTCCGCCGTGTCTTTATGATGGACAATTGTGAGGAGTTGATTCCTGAGTATTTGGGCTTT

Predicted protein sequences of Glyma10g12760

Limit To All Plant Sequences

>Glyma10g12760.1   sequence type=predicted peptide   gene model=Glyma10g12760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GPIVTTKHNDDEQYVWESDAGGSFTVTRDNTGEVLGRGTKITLYLKEDQLEYLEERRLKDLIKKHSEFISYPIFLWIEKTTEKEISDDEEGKVEDVDEEKEKEEKKKKKIKEVSHECSLVNKHKPIWMRKHEEITKEEYSAFYKSLTNDWEEHLAVKPFSGEGQLEFKAIVFVPKRAPFDLFDTRKKPNNIKLYVRRVFMMDNCEELIPEYLGF

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain