SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g12760

Feature Type:gene_model
Chromosome:Gm10
Start:14289218
stop:14289859
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g12760
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56030AT Annotation by Michelle Graham. TAIR10: heat shock protein 81-2 | chr5:22686923-22689433 FORWARD LENGTH=699 SoyBaseE_val: 7.00E-103ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0010187GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0050821GO-bp Annotation by Michelle Graham. GO Biological Process: protein stabilization SoyBaseN/AISS
GO:0090332GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal closure SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
PTHR11528Panther HEAT SHOCK PROTEIN 90 JGI ISS
PF00183PFAM Hsp90 protein JGI ISS
UniRef100_G7IDZ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein n=1 Tax=Medicago truncatula RepID=G7IDZ4_MEDTR SoyBaseE_val: 3.00E-109ISS
UniRef100_UPI000233D80DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D80D related cluster n=1 Tax=unknown RepID=UPI000233D80D SoyBaseE_val: 6.00E-153ISS

Expression Patterns of Glyma10g12760
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g12760 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g12760
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g12760
>Glyma10g12760.1   sequence type=CDS   gene model=Glyma10g12760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGCCCATTGTTACAACCAAACACAATGATGATGAACAATATGTTTGGGAGTCTGATGCTGGAGGTTCTTTCACTGTCACCAGGGATAACACTGGTGAGGTTCTTGGAAGGGGTACTAAGATCACTCTCTACCTCAAGGAAGATCAGCTTGAGTACCTTGAGGAGCGTCGCTTGAAGGATTTGATCAAGAAGCATTCTGAGTTCATTAGCTACCCAATTTTTCTTTGGATTGAGAAAACTACCGAGAAGGAGATCTCTGATGATGAGGAGGGTAAGGTGGAGGATGTTGACGAAGAGAAGGAGAAGGAAGAAAAAAAGAAAAAGAAGATTAAGGAAGTGTCACATGAATGCTCCTTGGTGAACAAGCACAAGCCCATTTGGATGAGAAAGCATGAGGAGATCACAAAGGAGGAGTATTCTGCTTTCTACAAGAGTCTCACCAATGACTGGGAAGAGCATTTGGCTGTCAAGCCCTTCTCAGGTGAGGGACAGTTGGAGTTTAAGGCTATCGTCTTTGTTCCTAAGAGGGCACCTTTTGACCTCTTTGACACAAGGAAGAAGCCTAACAATATTAAGCTTTATGTCCGCCGTGTCTTTATGATGGACAATTGTGAGGAGTTGATTCCTGAGTATTTGGGCTTT
Predicted protein sequences of Glyma10g12760
>Glyma10g12760.1   sequence type=predicted peptide   gene model=Glyma10g12760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GPIVTTKHNDDEQYVWESDAGGSFTVTRDNTGEVLGRGTKITLYLKEDQLEYLEERRLKDLIKKHSEFISYPIFLWIEKTTEKEISDDEEGKVEDVDEEKEKEEKKKKKIKEVSHECSLVNKHKPIWMRKHEEITKEEYSAFYKSLTNDWEEHLAVKPFSGEGQLEFKAIVFVPKRAPFDLFDTRKKPNNIKLYVRRVFMMDNCEELIPEYLGF






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo