SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g12740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g12740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g12740

Feature Type:gene_model
Chromosome:Gm10
Start:14285178
stop:14285998
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g12740
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27590AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF3453 (InterPro:IPR021850); BEST Arabidopsis thaliana protein match is: phosphatidylinositol 3- and 4-kinase family protein (TAIR:AT1G27570.1); Has 109 Blast hits to 109 proteins in 38 species: Archae - 0; Bacteria - 0; Metazoa - 65; Fungi - 4; Plants - 38; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink). | chr1:9592293-9593912 FORWARD LENGTH=264 SoyBaseE_val: 5.00E-23ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR15245Panther FAMILY NOT NAMED JGI ISS
PTHR15245:SF12Panther SUBFAMILY NOT NAMED JGI ISS
PF11935PFAM Domain of unknown function (DUF3453) JGI ISS
UniRef100_I1L9X8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9X8_SOYBN SoyBaseE_val: 6.00E-103ISS
UniRef100_Q9SFZ9UniRef Annotation by Michelle Graham. Most informative UniRef hit: T22C5.2 n=1 Tax=Arabidopsis thaliana RepID=Q9SFZ9_ARATH SoyBaseE_val: 2.00E-20ISS

Expression Patterns of Glyma10g12740
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g12740 not represented in the dataset
Glyma10g12740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g12740 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g115000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g12740
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g12740
>Glyma10g12740.1   sequence type=CDS   gene model=Glyma10g12740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATGCAATCACTCTCCTCTCTTTGAACTTGATAGACCAGATTGAAATATTGTTTGCTCTAATTTTAATCATGCTCCAAAGTTCAGACAAAAGTTTCATCTGCTCAAACCTACTTGTGATGGAGTTTCATCTGCTCAGACAAAAGGAATCTTATCAATGGGCTTTATTTATTTATTTTCTGATTAGAGAATTAATTTGCTTGTTGCTGGCCCTGAAGTTCTTGGAAACGTTTGTATTTCTCTTTTCATCTGACATCGGTGATACTGAGAAATTAGCCACAAAAGGAATTAGGCAAGCTGTTAATGTCGAATGGTTGGTTGGTGGTCACCCTCACCCTGTTCTTGATCCAGTGGTGCTCATATCAGATGCAAATAAGACTATTGGCATTCTATTAAATTTATTGCTGTTGGTTGGCAGTCTTCCAACTTGCTTGACTATTACTGTTGTAAATTGGTGA
Predicted protein sequences of Glyma10g12740
>Glyma10g12740.1   sequence type=predicted peptide   gene model=Glyma10g12740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYAITLLSLNLIDQIEILFALILIMLQSSDKSFICSNLLVMEFHLLRQKESYQWALFIYFLIRELICLLLALKFLETFVFLFSSDIGDTEKLATKGIRQAVNVEWLVGGHPHPVLDPVVLISDANKTIGILLNLLLLVGSLPTCLTITVVNW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo