Glyma10g12730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g12730

Feature Type:	gene_model
Chromosome:	Gm10
Start:	14282869
stop:	14283557
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g12730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G19990	AT	Annotation by Michelle Graham. TAIR10: regulatory particle triple-A ATPase 6A \| chr5:6752144-6754918 FORWARD LENGTH=419	SoyBase	E_val: 4.00E-25	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0030163	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein catabolic process	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0008540	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, base subcomplex	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
PTHR23073	Panther	26S PROTEASE REGULATORY SUBUNIT	JGI		ISS
PTHR23073:SF12	Panther	26S PROTEASE REGULATORY SUBUNIT 8	JGI		ISS
UniRef100_Q9SST5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: TAT-binding protein homolog n=1 Tax=Matricaria chamomilla RepID=Q9SST5_9ASTR	SoyBase	E_val: 4.00E-23	ISS
UniRef100_Q9SST5	UniRef	Annotation by Michelle Graham. Best UniRef hit: TAT-binding protein homolog n=1 Tax=Matricaria chamomilla RepID=Q9SST5_9ASTR	SoyBase	E_val: 4.00E-23	ISS

Expression Patterns of Glyma10g12730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g12730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g12730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g12730

Limit To All Plant Sequences

>Glyma10g12730.1   sequence type=CDS   gene model=Glyma10g12730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAGAAGACCGGTAGACTCTGTAGTGAGGAGAGTAGACCAGATGGAGAGAAGGCAAACAATTTGAGGCAGAGGAAGACCCAAAAAGACTATAAGAGAGTTGAGATCTTATTCTGTGACGCTGGTATAATTGATGACTTAATAAAAGAAGTAAGGCTGAATTATTTTTTCAGAATGTTGTATGAACCTGACCAACGCTCAAATTTTGTGCCTTTGCAGGCTGTTTGCACCGAAGCTGGAATGTTTGCATTGAGGGAGCGGAGGGTACACGTGACTCAGGAGGATTTTGAGATGGCTGTGGCCAAGGTGATGAAAAAAGAGACTGAAAAAAACATGTCATTGCGGAAGTTATGGAAGTGA

Predicted protein sequences of Glyma10g12730

Limit To All Plant Sequences

>Glyma10g12730.1   sequence type=predicted peptide   gene model=Glyma10g12730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EKTGRLCSEESRPDGEKANNLRQRKTQKDYKRVEILFCDAGIIDDLIKEVRLNYFFRMLYEPDQRSNFVPLQAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEKNMSLRKLWK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain