SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g12370

Feature Type:gene_model
Chromosome:Gm10
Start:13372223
stop:13373218
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g12370
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41905AT Annotation by Michelle Graham. TAIR10: BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr2:17495766-17495951 FORWARD LENGTH=61 SoyBaseE_val: 2.00E-13ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_D7LHZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LHZ7_ARALL SoyBaseE_val: 6.00E-10ISS
UniRef100_I1L9W6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9W6_SOYBN SoyBaseE_val: 1.00E-29ISS

Expression Patterns of Glyma10g12370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g12370 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g094600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g12370
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g12370
>Glyma10g12370.1   sequence type=CDS   gene model=Glyma10g12370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACATGAAGAAGGTTACCTGTGCCGTTCTCATCGCTGCCGCCTCCATGAGTGCAGCACTGGCTGCCACAGAGGTCCCTGCGCCCGCCCCTGGCCCTAGCAGCGGTGCCTCAGCCGCGGCCGCTGTCGGCTCCTTGGTTGGTGCCTCAGTCTTGTCCTTCTTTGCCTTGTTCCACTAA
Predicted protein sequences of Glyma10g12370
>Glyma10g12370.1   sequence type=predicted peptide   gene model=Glyma10g12370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDMKKVTCAVLIAAASMSAALAATEVPAPAPGPSSGASAAAAVGSLVGASVLSFFALFH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo