|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G44860 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L24e family protein | chr2:18501034-18502128 REVERSE LENGTH=159 | SoyBase | E_val: 3.00E-55 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| KOG1723 | KOG | 60s ribosomal protein L30 isolog | JGI | ISS | |
| PTHR10792 | Panther | 60S RIBOSOMAL PROTEIN L24 | JGI | ISS | |
| PTHR10792:SF3 | Panther | gb def: Putative ribosomal protein L30 (Fragment) | JGI | ISS | |
| PF01246 | PFAM | Ribosomal protein L24e | JGI | ISS | |
| UniRef100_B7FMU0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ribosome biogenesis protein rlp24 n=1 Tax=Medicago truncatula RepID=B7FMU0_MEDTR | SoyBase | E_val: 7.00E-57 | ISS |
| UniRef100_UPI000233D4FB | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D4FB related cluster n=1 Tax=unknown RepID=UPI000233D4FB | SoyBase | E_val: 2.00E-80 | ISS |
|
Glyma10g09802 not represented in the dataset |
Glyma10g09802 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.10g080100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma10g09802.1 sequence type=CDS gene model=Glyma10g09802 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGATTGGAGAAATGCTGGTTTTGCTCTTCAACCATATACCCTGGACATGGAATCCAGTTTGTTCGTAATGATGCAAAGATTTTTCGGTTTTGTAGATCTAAATGCCACAAGAACTTTAAAATGAAGAGAAATCCTCGTAAGGACTCAACTTTTGAGTTTGAGAGAAAGAGAAATAGGCCTGAAAGATATGACAGGAATCTTGCGGAGAATGTCCTCAAGGCCATTCCTAAGATTGATAAGATCAGAGTCTCGAGGGAGGAGAGACACCATAAGAACAATTTGGTCAAAGCTCGTTATGTGCTTCAACAGGATCCATCTCTCACTTTACCAAAGATCAAAGTCAAGGTTTCCCAACAGCAATCAGAGGAGAATCATGCCATGGAAGAGTAA
>Glyma10g09802.1 sequence type=predicted peptide gene model=Glyma10g09802 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKDSTFEFERKRNRPERYDRNLAENVLKAIPKIDKIRVSREERHHKNNLVKARYVLQQDPSLTLPKIKVKVSQQQSEENHAMEE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||