SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g09802): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g09802): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g09802

Feature Type:gene_model
Chromosome:Gm10
Start:9111599
stop:9112528
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44860AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L24e family protein | chr2:18501034-18502128 REVERSE LENGTH=159 SoyBaseE_val: 3.00E-55ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1723 KOG 60s ribosomal protein L30 isolog JGI ISS
PTHR10792Panther 60S RIBOSOMAL PROTEIN L24 JGI ISS
PTHR10792:SF3Panther gb def: Putative ribosomal protein L30 (Fragment) JGI ISS
PF01246PFAM Ribosomal protein L24e JGI ISS
UniRef100_B7FMU0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosome biogenesis protein rlp24 n=1 Tax=Medicago truncatula RepID=B7FMU0_MEDTR SoyBaseE_val: 7.00E-57ISS
UniRef100_UPI000233D4FBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D4FB related cluster n=1 Tax=unknown RepID=UPI000233D4FB SoyBaseE_val: 2.00E-80ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g09802 not represented in the dataset

Glyma10g09802 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g080100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g09802.1   sequence type=CDS   gene model=Glyma10g09802   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGATTGGAGAAATGCTGGTTTTGCTCTTCAACCATATACCCTGGACATGGAATCCAGTTTGTTCGTAATGATGCAAAGATTTTTCGGTTTTGTAGATCTAAATGCCACAAGAACTTTAAAATGAAGAGAAATCCTCGTAAGGACTCAACTTTTGAGTTTGAGAGAAAGAGAAATAGGCCTGAAAGATATGACAGGAATCTTGCGGAGAATGTCCTCAAGGCCATTCCTAAGATTGATAAGATCAGAGTCTCGAGGGAGGAGAGACACCATAAGAACAATTTGGTCAAAGCTCGTTATGTGCTTCAACAGGATCCATCTCTCACTTTACCAAAGATCAAAGTCAAGGTTTCCCAACAGCAATCAGAGGAGAATCATGCCATGGAAGAGTAA

>Glyma10g09802.1   sequence type=predicted peptide   gene model=Glyma10g09802   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKDSTFEFERKRNRPERYDRNLAENVLKAIPKIDKIRVSREERHHKNNLVKARYVLQQDPSLTLPKIKVKVSQQQSEENHAMEE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo