Report for Sequence Feature Glyma10g09640
Feature Type: gene_model
Chromosome: Gm10
Start: 8902079
stop: 8902813
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g09640
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G11650 AT
Annotation by Michelle Graham. TAIR10: NDR1/HIN1-like 2 | chr3:3676264-3676986 REVERSE LENGTH=240
SoyBase E_val: 2.00E-71 ISS
GO:0051607 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to virus
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR19957 Panther
SYNTAXIN
JGI ISS
PTHR19957:SF11 Panther
SYNTAXIN-RELATED
JGI ISS
PF03168 PFAM
Late embryogenesis abundant protein
JGI ISS
UniRef100_I1L9J2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9J2_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q8H1B5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Hin1-like protein n=1 Tax=Solanum tuberosum RepID=Q8H1B5_SOLTU
SoyBase E_val: 3.00E-71 ISS
Expression Patterns of Glyma10g09640
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma10g09640
Paralog Evidence Comments
Glyma02g35660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma10g09640 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g079400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g09640
Coding sequences of Glyma10g09640
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g09640.1 sequence type=CDS gene model=Glyma10g09640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCCCATCTAAACGGCGCCTACTACGGCCCCGCCGTTCCCCCGCCGAAATCCTACCACCGTCCCTCCCACGGCGGCGGCGGCCGCGACGGCTGCTGCTGCGGCTGCCTGAGCTGCTTCTGTGGCTGCATCTTCGACTGCATCCTCGGCCTAATCTGCAAGATCCTGACCACAATCATCATAATCCTGGCAGTTCTCGCTTTTCTGTTCTGGTTTATCGTGCGCCCCAACGTGATCAAATTCCACGTCACAGACGCCTCCCTCACGCGCTTCGACTACACCACCAACAACACTCTCCACTATGACCTCACTCTCAACGTGTCGATCCGCAACCCGAACCGCAGGGTCGGCGTCTACTACGATCAAATCGAAGCGCTCGCGCTGTACGAGGATGTTTTGTTCGGGAACCTGACATTGGGTTCTTTCTACCAGCACCACAAGAACACCACCTTCGTGAGTCCCATTTTCAAGGGCCAGCGCGTGACTCCACTCGCCAAGGTCCAGGTTTCGGAGTTTGACAAGGAAAAGGGTTCTGGGGTTTACACCATAGATTTGAAGCTCTTCATGACGGTTCGGTTCAAGTTCTTGCTGTTCAAGAGTGGGAGTTTGAAGCCCAAGATTCGGTGTGCGTTGCACGTGCCACTGAAATCGCGTAACGCAACAACCTCTCCGGACGCTGCGTTTCAACCCACTGAGTGCGATTGGGATTACGGGAAAAAGTGGTGGATCCATTAG
Predicted protein sequences of Glyma10g09640
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g09640.1 sequence type=predicted peptide gene model=Glyma10g09640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSHLNGAYYGPAVPPPKSYHRPSHGGGGRDGCCCGCLSCFCGCIFDCILGLICKILTTIIIILAVLAFLFWFIVRPNVIKFHVTDASLTRFDYTTNNTLHYDLTLNVSIRNPNRRVGVYYDQIEALALYEDVLFGNLTLGSFYQHHKNTTFVSPIFKGQRVTPLAKVQVSEFDKEKGSGVYTIDLKLFMTVRFKFLLFKSGSLKPKIRCALHVPLKSRNATTSPDAAFQPTECDWDYGKKWWIH*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
