| 
 | 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT1G61110 | AT | Annotation by Michelle Graham. TAIR10: NAC domain containing protein 25 | chr1:22516730-22518055 FORWARD LENGTH=323 | SoyBase | E_val: 3.00E-57 | ISS | 
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS | 
| GO:0007275 | GO-bp | Annotation by Michelle Graham. GO Biological Process: multicellular organismal development | SoyBase | N/A | ISS | 
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS | 
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS | 
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS | 
| PF02365 | PFAM | No apical meristem (NAM) protein | JGI | ISS | |
| UniRef100_G7L2R0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NAC domain transcription factor n=1 Tax=Medicago truncatula RepID=G7L2R0_MEDTR | SoyBase | E_val: 4.00E-71 | ISS | 
| UniRef100_I1L9H4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L9H4_SOYBN | SoyBase | E_val: 4.00E-87 | ISS | 
| Glyma10g09180 not represented in the dataset | Glyma10g09180 not represented in the dataset | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection | Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.10g077000 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 | 
>Glyma10g09180.1 sequence type=CDS gene model=Glyma10g09180 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATAAAGATGCTAATTCAAAAATCCAACTCCCTCCTGGATTTAGATTCCACCTTTCTTATGAGGAGCTAATTGTTCACTATCTGAGAAACAAAGTGACATCATCACCCCTTCCTGCTTCATTCATAGCAGAAATAGATCTTTACAACTATAATCCATGGGAGCTCCCAACTTTGTTTGGGGAGGATGAGTGGTATTTCTTTACTCCTAGAGATAGGAAGTATCCCAATGGAGTGAGGCCTAATAGAGCAACTACTTCTGGTTATTGGAAGCCTACCGGGACTGACAAACCCATTTTCACTTCCTGTGGGATGAAGAGCATTACTGTCAAGAAGGCACTCGTGTTCTACAAGGGTCGTCCACCAAAGGGATCGAAAACCGACTAG
>Glyma10g09180.1 sequence type=predicted peptide gene model=Glyma10g09180 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDKDANSKIQLPPGFRFHLSYEELIVHYLRNKVTSSPLPASFIAEIDLYNYNPWELPTLFGEDEWYFFTPRDRKYPNGVRPNRATTSGYWKPTGTDKPIFTSCGMKSITVKKALVFYKGRPPKGSKTD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||