SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g08340

Feature Type:gene_model
Chromosome:Gm10
Start:7175357
stop:7177049
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G27550AT Annotation by Michelle Graham. TAIR10: centroradialis | chr2:11773417-11774509 FORWARD LENGTH=175 SoyBaseE_val: 1.00E-92ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008429GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding SoyBaseN/AISS
KOG3346 KOG Phosphatidylethanolamine binding protein JGI ISS
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI ISS
PF01161PFAM Phosphatidylethanolamine-binding protein JGI ISS
UniRef100_G7Z0B5UniRef Annotation by Michelle Graham. Most informative UniRef hit: CENTRORADIALIS-like protein 2 n=1 Tax=Glycine max RepID=G7Z0B5_SOYBN SoyBaseE_val: 1.00E-125ISS
UniRef100_G7Z0B5UniRef Annotation by Michelle Graham. Best UniRef hit: CENTRORADIALIS-like protein 2 n=1 Tax=Glycine max RepID=G7Z0B5_SOYBN SoyBaseE_val: 1.00E-125ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g22030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g071400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g08340.1   sequence type=CDS   gene model=Glyma10g08340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGGATGTCGACAGATCCTCTAATTATTGGGAGAGTCATAGGAGATGTTCTTGGCTCTTTCACCCCAACCATAAAAATGACCGTAACTTACAATAAGAAGCAAGTCTACAATGGGTACGAGTTCTTCCCTTCCACAATTACCACAAGGCCAAGGGTTGAGATTGGTGGAGGAGATATGAGGTCCTTCTATACACTGATTATGACAGACCCGGATGTCCCTGGCCCTAGTGATCCTTACCTGAGAGAGCATTTGCACTGGATGGTGACAGACATTCCAGGCACAACAAATGCCTCATTTGGGAAAGTGTTGGTGAGCTATGAGATGCCAAACCCTAACATTGGGATACACAGGTATGTGTTTGTCCTGTTGAAGCAAAAACGTAGGCAGTGTGTAACTCGTCCACCTTCTTCAAGGGATCACTTCAACACTCGCAAATTCTCAGCTGAGAATGACCTTGGCCTCCCTGTTGCTGCTGTCTACTTCAATGCACAGAGGGAAACTGCTGCAAGAAGACGCTAG

>Glyma10g08340.1   sequence type=predicted peptide   gene model=Glyma10g08340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARMSTDPLIIGRVIGDVLGSFTPTIKMTVTYNKKQVYNGYEFFPSTITTRPRVEIGGGDMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGKVLVSYEMPNPNIGIHRYVFVLLKQKRRQCVTRPPSSRDHFNTRKFSAENDLGLPVAAVYFNAQRETAARRR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo