SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma10g07850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma10g07850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma10g07850

Feature Type:gene_model
Chromosome:Gm10
Start:6641273
stop:6642835
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G44590AT Annotation by Michelle Graham. TAIR10: 60S acidic ribosomal protein family | chr3:16163983-16164658 FORWARD LENGTH=111 SoyBaseE_val: 2.00E-28ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006414GO-bp Annotation by Michelle Graham. GO Biological Process: translational elongation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3449 KOG 60S acidic ribosomal protein P2 JGI ISS
PTHR21141Panther 60S ACIDIC RIBOSOMAL PROTEIN FAMILY MEMBER JGI ISS
PF00428PFAM 60s Acidic ribosomal protein JGI ISS
UniRef100_A8QJ72UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S acidic ribosomal protein P2 n=1 Tax=Juglans regia RepID=A8QJ72_9ROSI SoyBaseE_val: 6.00E-31ISS
UniRef100_C6T1E4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1E4_SOYBN SoyBaseE_val: 4.00E-69ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g07850 not represented in the dataset

Glyma10g07850 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g067800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g07850.2   sequence type=CDS   gene model=Glyma10g07850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGTGGTCGCTGCGTATCTGCTCGCCGTCCTCGGTGGCAACAACACCCCCTCCGCCGATGACATCAAGGAAATCCTCGGCTCCGTTGGAATAGAGGCAGATGAAGATAGGATTGAATCGTTCTTGTCTGAAGTTAAGGGTAAGGATATAGTTGAGCTAATTGCTGCCGGTAAGGAAAAGCTGGCCTCGGTGCCTTCTGGTGGCGGTGGTGCCGTTGCCGTCGCCGCTGCTCCTGGTGGAGGTGGCGGTGGTGCTGCTCCGGCTGCTGAGGTAAAGAAAGAGGAAAAGGTGGAGGAGAAAGAGGAATCTGATGATGATATGGGTTTCAGTCTCTTCGATTAA

>Glyma10g07850.2   sequence type=predicted peptide   gene model=Glyma10g07850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKVVAAYLLAVLGGNNTPSADDIKEILGSVGIEADEDRIESFLSEVKGKDIVELIAAGKEKLASVPSGGGGAVAVAAAPGGGGGGAAPAAEVKKEEKVEEKEESDDDMGFSLFD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo