SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g07756

Feature Type:gene_model
Chromosome:Gm10
Start:6544808
stop:6545365
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G25490AT Annotation by Michelle Graham. TAIR10: C-repeat/DRE binding factor 1 | chr4:13021921-13022562 REVERSE LENGTH=213 SoyBaseE_val: 1.00E-39ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009631GO-bp Annotation by Michelle Graham. GO Biological Process: cold acclimation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_B9SRI0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dehydration-responsive element-binding protein 1B, putative n=1 Tax=Ricinus communis RepID=B9SRI0_RICCO SoyBaseE_val: 7.00E-58ISS
UniRef100_UPI000233CF78UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CF78 related cluster n=1 Tax=unknown RepID=UPI000233CF78 SoyBaseE_val: 2.00E-135ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g07756 not represented in the dataset

Glyma10g07756 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g21570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g067000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g07756.1   sequence type=CDS   gene model=Glyma10g07756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAAGCGGAGGGCAGGGAGGAAGAAGTTCCACGAGACACGACACCCGGTGTACAAGGGAGTGAGGCAGAGGAACGGGAAGTGGGTAAGCGAGCTGCGACAACCTAACAACAAAAACGCGCGGGTGTGGCTCGGAACATTCCCGCACCCCGACATGGCTGCTATAGCGTACGATGTTGCCGCCTTGGCTTTCAAGGGCGACAGTGCTTCCTTAAACTTCCCGAACGCCGCCACCTCGTTTCCCCGCCTTAACTCGCGGACGTGTTCCGTTAGGGCCATTCAGTTTGCGGCGACGCAGGCGGCGGAGAAGCATTTTTCTTGTGTAGAGTCTCAACAACTCCAAAGGGAGGGATCAGGCTCCGGAAGCTTCTCTTTGGACGATGATTCTTCGGAGTTTTCGTCCCAAGGAAGGTTCTTTTGGGATGAAGAGGAAGTGTTTAACATGCCGGAGTTGCTGAACTGCATGGCGGAAGCGCTGATTATCACACCGCCGGCGTTGGAAAGAGGGTTCAATTGGGTTGGTGGCGAAACGACTGTGGATTTGACTCTGTGGTGA

>Glyma10g07756.1   sequence type=predicted peptide   gene model=Glyma10g07756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQKRRAGRKKFHETRHPVYKGVRQRNGKWVSELRQPNNKNARVWLGTFPHPDMAAIAYDVAALAFKGDSASLNFPNAATSFPRLNSRTCSVRAIQFAATQAAEKHFSCVESQQLQREGSGSGSFSLDDDSSEFSSQGRFFWDEEEVFNMPELLNCMAEALIITPPALERGFNWVGGETTVDLTLW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo