Glyma10g07756 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g07756

Feature Type:	gene_model
Chromosome:	Gm10
Start:	6544808
stop:	6545365
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g07756

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25490	AT	Annotation by Michelle Graham. TAIR10: C-repeat/DRE binding factor 1 \| chr4:13021921-13022562 REVERSE LENGTH=213	SoyBase	E_val: 1.00E-39	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cold acclimation	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_B9SRI0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dehydration-responsive element-binding protein 1B, putative n=1 Tax=Ricinus communis RepID=B9SRI0_RICCO	SoyBase	E_val: 7.00E-58	ISS
UniRef100_UPI000233CF78	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CF78 related cluster n=1 Tax=unknown RepID=UPI000233CF78	SoyBase	E_val: 2.00E-135	ISS

Expression Patterns of Glyma10g07756

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g07756 not represented in the dataset	Glyma10g07756 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g07756

Paralog	Evidence	Comments
Glyma13g21570	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g07756 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g067000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g07756

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g07756

Limit To All Plant Sequences

>Glyma10g07756.1   sequence type=CDS   gene model=Glyma10g07756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAAGCGGAGGGCAGGGAGGAAGAAGTTCCACGAGACACGACACCCGGTGTACAAGGGAGTGAGGCAGAGGAACGGGAAGTGGGTAAGCGAGCTGCGACAACCTAACAACAAAAACGCGCGGGTGTGGCTCGGAACATTCCCGCACCCCGACATGGCTGCTATAGCGTACGATGTTGCCGCCTTGGCTTTCAAGGGCGACAGTGCTTCCTTAAACTTCCCGAACGCCGCCACCTCGTTTCCCCGCCTTAACTCGCGGACGTGTTCCGTTAGGGCCATTCAGTTTGCGGCGACGCAGGCGGCGGAGAAGCATTTTTCTTGTGTAGAGTCTCAACAACTCCAAAGGGAGGGATCAGGCTCCGGAAGCTTCTCTTTGGACGATGATTCTTCGGAGTTTTCGTCCCAAGGAAGGTTCTTTTGGGATGAAGAGGAAGTGTTTAACATGCCGGAGTTGCTGAACTGCATGGCGGAAGCGCTGATTATCACACCGCCGGCGTTGGAAAGAGGGTTCAATTGGGTTGGTGGCGAAACGACTGTGGATTTGACTCTGTGGTGA

Predicted protein sequences of Glyma10g07756

Limit To All Plant Sequences

>Glyma10g07756.1   sequence type=predicted peptide   gene model=Glyma10g07756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQKRRAGRKKFHETRHPVYKGVRQRNGKWVSELRQPNNKNARVWLGTFPHPDMAAIAYDVAALAFKGDSASLNFPNAATSFPRLNSRTCSVRAIQFAATQAAEKHFSCVESQQLQREGSGSGSFSLDDDSSEFSSQGRFFWDEEEVFNMPELLNCMAEALIITPPALERGFNWVGGETTVDLTLW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain