SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g07680

Feature Type:gene_model
Chromosome:Gm10
Start:6430740
stop:6432987
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g07680
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36620AT Annotation by Michelle Graham. TAIR10: ribosomal protein L24 | chr2:15350548-15351819 REVERSE LENGTH=164 SoyBaseE_val: 6.00E-83ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1722 KOG 60s ribosomal protein L24 JGI ISS
PTHR10792Panther 60S RIBOSOMAL PROTEIN L24 JGI ISS
PF01246PFAM Ribosomal protein L24e JGI ISS
UniRef100_I1L981UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L981_SOYBN SoyBaseE_val: 1.00E-112ISS
UniRef100_Q9FUL4UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L24 n=1 Tax=Prunus avium RepID=RL24_PRUAV SoyBaseE_val: 6.00E-87ISS

Expression Patterns of Glyma10g07680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g07680
ParalogEvidenceComments
Glyma13g21520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g07680 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g066500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g07680
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g07680
>Glyma10g07680.1   sequence type=CDS   gene model=Glyma10g07680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTCTCAAAACCGAACTATGCCGATTCAGCGGTGCCAAGATCTACCCAGGGAAAGGCATCAGATTTGTTCGTGGTGATTCTCAGGTTTTCCTGTTTGCTAACTCGAAATGTAAGAGGTATTTCCACAACAGGTTGAAGCCATCAAAGCTCACCTGGACTGCAATGTACAGAAAGCAACACAAGAAGGACATTGCTCAAGAAGCTGTGAAGAAAAGAAGACGTGCTGCCAAAAAGCCTTACTCCAGGTCCATTGTCGGTGCCACTTTGGAAGTTATCCAGAAAAAGAGAGCTGAGAAGCCAGAAGTTCGAGATGCAAATAGGGAAGCTGCCCTTCGTGAAATTAAGGAGAGGAACAAGAAAACAAAGGATGAGAAGAAGGCTAAGAAAGCAGAGTTTGCCAAGTCCCAAAAATCACAAGGGAAAGGAAATGTTTCGAAGGGTGCCATGCCCAAAGGTCCCAAACTTGGTGGTGGAGGCGGGAAACGCTGA
Predicted protein sequences of Glyma10g07680
>Glyma10g07680.1   sequence type=predicted peptide   gene model=Glyma10g07680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLKTELCRFSGAKIYPGKGIRFVRGDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAQEAVKKRRRAAKKPYSRSIVGATLEVIQKKRAEKPEVRDANREAALREIKERNKKTKDEKKAKKAEFAKSQKSQGKGNVSKGAMPKGPKLGGGGGKR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo