Glyma10g07580 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g07580

Feature Type:	gene_model
Chromosome:	Gm10
Start:	6300844
stop:	6302873
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g07580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G52940	AT	Annotation by Michelle Graham. TAIR10: Ergosterol biosynthesis ERG4/ERG24 family \| chr3:19630369-19633112 REVERSE LENGTH=369	SoyBase	E_val: 4.00E-75	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0019745	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016628	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor	SoyBase	N/A	ISS
GO:0050613	GO-mf	Annotation by Michelle Graham. GO Molecular Function: delta14-sterol reductase activity	SoyBase	N/A	ISS
PTHR21257	Panther	STEROL REDUCTASE-RELATED	JGI		ISS
PTHR21257:SF21	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF01222	PFAM	Ergosterol biosynthesis ERG4/ERG24 family	JGI		ISS
UniRef100_B9SRG4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: C-14 sterol reductase, putative n=1 Tax=Ricinus communis RepID=B9SRG4_RICCO	SoyBase	E_val: 1.00E-74	ISS
UniRef100_I1L973	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L973_SOYBN	SoyBase	E_val: 1.00E-87	ISS

Expression Patterns of Glyma10g07580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g07580

Paralog	Evidence	Comments
Glyma13g21450	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g07580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma10g07580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g07580

Limit To All Plant Sequences

>Glyma10g07580.1   sequence type=CDS   gene model=Glyma10g07580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGTTTTTGGAGATTTAGTGTGGATTCCTTTCACTTTTAGCATACAGGGGTGGTGGCTCTTGATGAACAGTGTGGAGTCAACACCAGCTGCCATTGTAGCTAATTGCTTTGTCTTCCTGATTGGATACATGGTATTTCGAGGAGCAAACAAGCAAAACCATGTATTCAAAAAGAATCCAAAGGCTCGTATTTGGGGTAAGCCTCCAAAAGTCATTGGCGGAAAGCTACTTGCTTCTGGTTATTGGGGTATTGCTAGACGCTGTAATTACCTAGGGGATTTGATGCTTGCTCTCTCCTTTAGCTTACCATGTGGGATAAGTTCACCAATTCCATACTTCTATCCAGTTTATCTTCTTATTCTGTTAATCTGGAGAGAGAAGGGATGA

Predicted protein sequences of Glyma10g07580

Limit To All Plant Sequences

>Glyma10g07580.1   sequence type=predicted peptide   gene model=Glyma10g07580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLVFGDLVWIPFTFSIQGWWLLMNSVESTPAAIVANCFVFLIGYMVFRGANKQNHVFKKNPKARIWGKPPKVIGGKLLASGYWGIARRCNYLGDLMLALSFSLPCGISSPIPYFYPVYLLILLIWREKG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain