SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g07146

Feature Type:gene_model
Chromosome:Gm10
Start:5846110
stop:5847760
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g07146
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63180AT Annotation by Michelle Graham. TAIR10: UDP-D-glucose/UDP-D-galactose 4-epimerase 3 | chr1:23427559-23429384 REVERSE LENGTH=351 SoyBaseE_val: 1.00E-11ISS
GO:0006012GO-bp Annotation by Michelle Graham. GO Biological Process: galactose metabolic process SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0044237GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metabolic process SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003978GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-glucose 4-epimerase activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
PF10440PFAM WIYLD domain JGI ISS
UniRef100_I1L935UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L935_SOYBN SoyBaseE_val: 5.00E-38ISS
UniRef100_Q6XP48UniRef Annotation by Michelle Graham. Most informative UniRef hit: UDP-Glc-4-epimerase n=1 Tax=Solanum tuberosum RepID=Q6XP48_SOLTU SoyBaseE_val: 8.00E-11ISS

Expression Patterns of Glyma10g07146
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g07146 not represented in the dataset
Glyma10g07146 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g07146 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g07146
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g07146
>Glyma10g07146.1   sequence type=CDS   gene model=Glyma10g07146   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGTGCTTACACCACCATCGCCGCCGATGCCATTGCTCGCTTCCAGGTGTATGGTGGAAATCTAGGATGGTGCTTTATTGAAGAGGCCTATTACAAGCTCCTACTGGAGGCCCTACTTAGCAAACAACAAGGTTCTGCAGAATATAAGAAAATTCCATTAAAAATGTGTCCCAGAAGACCCGGGGATGCTACTGCTGTATATGCATCTATGGACAAGGCTGAGAAAGAACTTGGTTGGAATGTAGCGGCTAAAGTGCCAAATGCAGTGTTAAACGACCACCAGTTGAAGTATGAAAATTTTAGCACTTTTTCTTTGGGTCTGAAGTCATCGAATTGGTCAGCACCAAAAGTTGACATGTTGGGCTTCAGCACGCCACTGCCAATGGCTACATTGTGTGTGCAATATGAAGCTGATTTCAGACCAAACATGAGCATTTGTAAAAAGAAGAGGAAAAAACTTTAG
Predicted protein sequences of Glyma10g07146
>Glyma10g07146.1   sequence type=predicted peptide   gene model=Glyma10g07146   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSAYTTIAADAIARFQVYGGNLGWCFIEEAYYKLLLEALLSKQQGSAEYKKIPLKMCPRRPGDATAVYASMDKAEKELGWNVAAKVPNAVLNDHQLKYENFSTFSLGLKSSNWSAPKVDMLGFSTPLPMATLCVQYEADFRPNMSICKKKRKKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo