SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g07133

Feature Type:gene_model
Chromosome:Gm10
Start:5844545
stop:5845592
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g07133
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47060AT Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr2:19333116-19334759 REVERSE LENGTH=397 SoyBaseE_val: 6.00E-13ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF870Panther JGI ISS
UniRef100_C6ZRX5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pto kinase interactor n=1 Tax=Glycine max RepID=C6ZRX5_SOYBN SoyBaseE_val: 3.00E-08ISS
UniRef100_I1L935UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L935_SOYBN SoyBaseE_val: 2.00E-44ISS

Expression Patterns of Glyma10g07133
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g07133 not represented in the dataset
Glyma10g07133 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g07133 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma10g07133
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g07133
>Glyma10g07133.1   sequence type=CDS   gene model=Glyma10g07133   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACGACTTTGGCTACACCAAAACTCAGTGAGGATAAAGTCAGGCAGTGTGTTGATACAAGACTAGGAGGAGAATACCCACCCAAAGCTGTTGCTAAGTATAAGGTCAGTCTGGCCCCGGGGAGCGGGTGTATTGAGGTAAATTTACAGCTCTGCCTCTGCTCCGAAAGAGCATTCTCCAATAACGGTTTCACTCCTTCTGTCGCACCGCTGCAGATAAAAAGAAAGATTCTTTACCAGCTCTAA
Predicted protein sequences of Glyma10g07133
>Glyma10g07133.1   sequence type=predicted peptide   gene model=Glyma10g07133   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATTLATPKLSEDKVRQCVDTRLGGEYPPKAVAKYKVSLAPGSGCIEVNLQLCLCSERAFSNNGFTPSVAPLQIKRKILYQL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo