SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g07075

Feature Type:gene_model
Chromosome:Gm10
Start:5805752
stop:5808166
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G38660AT Annotation by Michelle Graham. TAIR10: Pathogenesis-related thaumatin superfamily protein | chr4:18066448-18067984 REVERSE LENGTH=345 SoyBaseE_val: 1.00E-37ISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0048653GO-bp Annotation by Michelle Graham. GO Biological Process: anther development SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00314PFAM Thaumatin family JGI ISS
UniRef100_B9S0C6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein P21, putative n=1 Tax=Ricinus communis RepID=B9S0C6_RICCO SoyBaseE_val: 2.00E-78ISS
UniRef100_UPI000233CDFAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CDFA related cluster n=1 Tax=unknown RepID=UPI000233CDFA SoyBaseE_val: 5.00E-175ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g07075 not represented in the dataset

Glyma10g07075 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g062100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g07075.1   sequence type=CDS   gene model=Glyma10g07075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAAGAACGTCTCTCTGAATCTTTTTCTTCCCATGCTGCTGCTATGTGCAGGAGTGCAATCTGACGTGACTTTCACTTTCGAGAACTTATGCTCGGACACCCTGTGGCGCGCCTCAAACCCTAGCATCGGAGACTTGGAGCCAGACCTTCCCCGCGACACCTACGAGATATTCAACATGGACGACCACTACAGCGGCTCCATCTGGGTTCGAACCGGTTGCTCCACCAACGCATCGAACTACTTCTCGTGCGAAACCGGCGACTGTGGCAACGGGATCATGGAGTGTGCAGGCCTCAACCCCTCATTCCCAATAACCCAATTAAACTTCGTTGTGAACAACCCTATTGTGTCCTACGAAGTGAGCTTGAAGCATGGCCAAAACATGTTGGTTCGAATCAAACCAAATGGTGGAACCCTCGTGGACGGTTCAGGGCCATGCCCTATGGTGGATTGCAACAAAGAGCTTTCTAGTGTGTGCCCTTTGGATTTGATTGCTGGGAACAAGAATGACCAATATGTGGGATGTAATAGTCCTTGTGATGGGTATAAGGACCCTAAATATTGTTGCAATGGCAATGGTTGCCAACCGGATGAGATTTCCGTGAAGTACAAAGGGCTTTGTCCGTTTGCTCATACTTACCCTGGGGACAATCAACCTCCGATTTATCAGTGTAAAGGGGCTGATAGTTATGATATAACCTTTTGTCCTGCCCTTTAG

>Glyma10g07075.1   sequence type=predicted peptide   gene model=Glyma10g07075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKNVSLNLFLPMLLLCAGVQSDVTFTFENLCSDTLWRASNPSIGDLEPDLPRDTYEIFNMDDHYSGSIWVRTGCSTNASNYFSCETGDCGNGIMECAGLNPSFPITQLNFVVNNPIVSYEVSLKHGQNMLVRIKPNGGTLVDGSGPCPMVDCNKELSSVCPLDLIAGNKNDQYVGCNSPCDGYKDPKYCCNGNGCQPDEISVKYKGLCPFAHTYPGDNQPPIYQCKGADSYDITFCPAL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo