|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G44210 | AT | Annotation by Michelle Graham. TAIR10: erf domain protein 9 | chr5:17806742-17807344 FORWARD LENGTH=200 | SoyBase | E_val: 2.00E-33 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0006857 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oligopeptide transport | SoyBase | N/A | ISS |
| GO:0009873 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0045892 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| PF00847 | PFAM | AP2 domain | JGI | ISS | |
| UniRef100_G7ISE8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7ISE8_MEDTR | SoyBase | E_val: 7.00E-37 | ISS |
| UniRef100_I1KKS0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KKS0_SOYBN | SoyBase | E_val: 4.00E-46 | ISS |
|
Glyma10g07005 not represented in the dataset |
Glyma10g07005 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma10g07005.1 sequence type=CDS gene model=Glyma10g07005 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTGGATCATACCTCTGCACTGGAAGTCAAAACGGGGGGCGTCAAAAGAGAGCTAGATGTGCATTTTCGTGGAGTGAGAAAGAGGCCATGGGGGAGATACGCCTCGAAGATCAGAGATCCCAGCCAGAAGAGCCGCGTCTGGCTCGGAACCTTCGACACTGCGGAGGCGACAGCGCGTGCCTACGACGCCGCAGCACGAGAGTTTCGTGGCCCTAAGGCCAAGACAAACTTCCCTCTCCCTTTGGAAAATGTTAAGAACTTGAGCCCCAGCTAG
>Glyma10g07005.1 sequence type=predicted peptide gene model=Glyma10g07005 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLDHTSALEVKTGGVKRELDVHFRGVRKRPWGRYASKIRDPSQKSRVWLGTFDTAEATARAYDAAAREFRGPKAKTNFPLPLENVKNLSPS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||