Glyma10g06960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g06960

Feature Type:	gene_model
Chromosome:	Gm10
Start:	5720991
stop:	5721569
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g06960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G19320	AT	Annotation by Michelle Graham. TAIR10: Pathogenesis-related thaumatin superfamily protein \| chr1:6679327-6680178 FORWARD LENGTH=247	SoyBase	E_val: 7.00E-35	ISS
GO:0051707	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to other organism	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF00314	PFAM	Thaumatin family	JGI		ISS
UniRef100_G7L3Y5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thaumatin-like protein n=1 Tax=Medicago truncatula RepID=G7L3Y5_MEDTR	SoyBase	E_val: 3.00E-59	ISS
UniRef100_I1L928	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L928_SOYBN	SoyBase	E_val: 4.00E-114	ISS

Expression Patterns of Glyma10g06960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g06960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g061100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g06960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g06960

Limit To All Plant Sequences

>Glyma10g06960.2   sequence type=CDS   gene model=Glyma10g06960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATGGCCAGTAACCCAAACCGGTGATCAAAAGCCGCAATTATCAACAACAGGTTTCGAGCTGAGTTGGCTCCAGGAGCATCAAACTCTGTACGTGGACCTTCCATCACCATGGTCGAGTGCGTTCCGTGCTCGAACTGAATGCTCCAACAACAACGGAAGGTTCAACTGCGCCACTGTCGACTGCACCTCCAATCAAGTCGCATGCAATGGTGCTGGTTCAATCCTGCCGGCAACCAAGGCAGAAATTACCGTTGCAGAAAACAGAGGACAAGATTTCTACGACATGAGCAACGTGGACGACTTCAACATACCCATGTCCTTAACCGCACAAGGTGGAAGTGGCGATTACAAAACCTTAGGTTGTCTTAGGAACATCAACCATGTGTGTCCTTCGCAGCTACAACAACCAGGGCCTAGTGGCAATGTCATCGCTTGCAAGAGTGCTTGTGTGGCTTTCAATGCAGATCGATATTGTTACTTAGGAGATTACTTAGGAGATCGATATTGTTTTGGGGTTTTGTTTATGCCAGCCCCTTTTCGGCTAGTCTTCAATATTAAACCTTTCAAAGAGTAA

Predicted protein sequences of Glyma10g06960

Limit To All Plant Sequences

>Glyma10g06960.2   sequence type=predicted peptide   gene model=Glyma10g06960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLWPVTQTGDQKPQLSTTGFELSWLQEHQTLYVDLPSPWSSAFRARTECSNNNGRFNCATVDCTSNQVACNGAGSILPATKAEITVAENRGQDFYDMSNVDDFNIPMSLTAQGGSGDYKTLGCLRNINHVCPSQLQQPGPSGNVIACKSACVAFNADRYCYLGDYLGDRYCFGVLFMPAPFRLVFNIKPFKE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain