SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g06960

Feature Type:gene_model
Chromosome:Gm10
Start:5720991
stop:5721569
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19320AT Annotation by Michelle Graham. TAIR10: Pathogenesis-related thaumatin superfamily protein | chr1:6679327-6680178 FORWARD LENGTH=247 SoyBaseE_val: 7.00E-35ISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00314PFAM Thaumatin family JGI ISS
UniRef100_G7L3Y5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thaumatin-like protein n=1 Tax=Medicago truncatula RepID=G7L3Y5_MEDTR SoyBaseE_val: 3.00E-59ISS
UniRef100_I1L928UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L928_SOYBN SoyBaseE_val: 4.00E-114ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g061100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g06960.2   sequence type=CDS   gene model=Glyma10g06960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATGGCCAGTAACCCAAACCGGTGATCAAAAGCCGCAATTATCAACAACAGGTTTCGAGCTGAGTTGGCTCCAGGAGCATCAAACTCTGTACGTGGACCTTCCATCACCATGGTCGAGTGCGTTCCGTGCTCGAACTGAATGCTCCAACAACAACGGAAGGTTCAACTGCGCCACTGTCGACTGCACCTCCAATCAAGTCGCATGCAATGGTGCTGGTTCAATCCTGCCGGCAACCAAGGCAGAAATTACCGTTGCAGAAAACAGAGGACAAGATTTCTACGACATGAGCAACGTGGACGACTTCAACATACCCATGTCCTTAACCGCACAAGGTGGAAGTGGCGATTACAAAACCTTAGGTTGTCTTAGGAACATCAACCATGTGTGTCCTTCGCAGCTACAACAACCAGGGCCTAGTGGCAATGTCATCGCTTGCAAGAGTGCTTGTGTGGCTTTCAATGCAGATCGATATTGTTACTTAGGAGATTACTTAGGAGATCGATATTGTTTTGGGGTTTTGTTTATGCCAGCCCCTTTTCGGCTAGTCTTCAATATTAAACCTTTCAAAGAGTAA

>Glyma10g06960.2   sequence type=predicted peptide   gene model=Glyma10g06960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLWPVTQTGDQKPQLSTTGFELSWLQEHQTLYVDLPSPWSSAFRARTECSNNNGRFNCATVDCTSNQVACNGAGSILPATKAEITVAENRGQDFYDMSNVDDFNIPMSLTAQGGSGDYKTLGCLRNINHVCPSQLQQPGPSGNVIACKSACVAFNADRYCYLGDYLGDRYCFGVLFMPAPFRLVFNIKPFKE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo