Report for Sequence Feature Glyma10g06830
Feature Type: gene_model
Chromosome: Gm10
Start: 5584174
stop: 5586606
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g06830
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G20030 AT
Annotation by Michelle Graham. TAIR10: Pathogenesis-related thaumatin superfamily protein | chr1:6945725-6947017 FORWARD LENGTH=316
SoyBase E_val: 2.00E-80 ISS
GO:0051707 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to other organism
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0031225 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF00314 PFAM
Thaumatin family
JGI ISS
UniRef100_G7L3Y5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Thaumatin-like protein n=1 Tax=Medicago truncatula RepID=G7L3Y5_MEDTR
SoyBase E_val: 2.00E-116 ISS
UniRef100_I1L923 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L923_SOYBN
SoyBase E_val: 4.00E-162 ISS
Expression Patterns of Glyma10g06830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma10g06830 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g060300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g06830
Coding sequences of Glyma10g06830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g06830.1 sequence type=CDS gene model=Glyma10g06830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATGAGCAACATTTTTTCTCTCTGCCTCAGTTTTTCATTACTCTTCTACGTGGCTCAGGGAGCCACAGTTACTTTCACAAACAATTGCCAATACACGGTGTGGCCAGGAACCCTAACCGGAGACCAAAATCCTCAGCTGTCAACAACCGGTTTCGAGTTGGCTCCCGGAGGAACCAACTCTGTGAACATTCCATCTCCATGGTCGGGCCGGTTTTGGGCCCGAACCGGATGCTCCAACAACGGAGGGTTTACATGCGACACCGGAGACTGTGCCTCCGGTCAAGTCGAATGCAACGGTGCCGGTGCAATCCCACCCGCTACTTTGGTGGAAATCACCGTTGCACCGAACGGAGGACAAGATTTCTACGACGTGAGCAACGTGGACGGGTTCAATGTGCCGGTGTCCATAACCCCACAAGGTGGAAGTGGCGAATGCAAAACCTCTAGTTGTCCAAATAACATCAACGATGTCAATGTGTGCCCTTCGGAGCTCCAAGTGAAAGGGTCTGATGGTAATGTCATTGCTTGCAATAGTGCTTGTGTGGCTTTCAATGAAGATCAATATTGTTGCAGAGGAGATTACGACACAGAAGAGACATGTCCACCTACGAACTACTCTCAGATTTTCGAGGAGCAGTGTCCTGATGCTTATTCCTACGCTTACGATGATAAGAGCAGCACTTTCACTTGCTTCAACGGACCTGACTATGCCATCATATTCTGCCCTTGA
Predicted protein sequences of Glyma10g06830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g06830.1 sequence type=predicted peptide gene model=Glyma10g06830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MMSNIFSLCLSFSLLFYVAQGATVTFTNNCQYTVWPGTLTGDQNPQLSTTGFELAPGGTNSVNIPSPWSGRFWARTGCSNNGGFTCDTGDCASGQVECNGAGAIPPATLVEITVAPNGGQDFYDVSNVDGFNVPVSITPQGGSGECKTSSCPNNINDVNVCPSELQVKGSDGNVIACNSACVAFNEDQYCCRGDYDTEETCPPTNYSQIFEEQCPDAYSYAYDDKSSTFTCFNGPDYAIIFCP*