Glyma10g06515 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g06515

Feature Type:	gene_model
Chromosome:	Gm10
Start:	5219836
stop:	5220756
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g06515

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G37000	AT	Annotation by Michelle Graham. TAIR10: TCP family transcription factor \| chr2:15540390-15540956 FORWARD LENGTH=188	SoyBase	E_val: 1.00E-43	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR11584	Panther	SERINE/THREONINE PROTEIN KINASE	JGI		ISS
PTHR11584:SF275	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF03634	PFAM	TCP family transcription factor	JGI		ISS
UniRef100_D1MJ53	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proliferating cell nuclear antigen gene-controlling element binding factor (Fragment) n=1 Tax=Pisum sativum RepID=D1MJ53_PEA	SoyBase	E_val: 1.00E-69	ISS
UniRef100_I1LZ85	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1LZ85_SOYBN	SoyBase	E_val: 2.00E-94	ISS

Expression Patterns of Glyma10g06515

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g06515 not represented in the dataset	Glyma10g06515 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g06515

Paralog	Evidence	Comments
Glyma13g20710	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g06515 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g057400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g06515

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g06515

Limit To All Plant Sequences

>Glyma10g06515.1   sequence type=CDS   gene model=Glyma10g06515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCTCACAAGTTGTCCTACACAACAATTTCGAAACCCAACCCTCCGTCACCGTCACCACCGCCACCAACACCGAGTCTCCACCCACCGCGCCACCGTCACTCGCCGTCGTCAAGAGACCCTCCACCAAGGACCGCCACACCAAGGTAAACGGCCGCGGCCGCCGCATCCGCATGCCACCGCTCTGCGCCGCGCGCATTTTCCAGCTCACGCGCGAGCTCGGCCACCGCTCCGACGGCGAGACGATCGAGTGGCTCCTCCGCCACGCCGAGCCCTCCATCATCGCCGCCACCGGCTCCGGCACCGTCCCCGCCGCCCCCGTCTCCTCCGTTGCGCCCTCCGCTCCCTCCTCCGAGCCCATGGTCGCCTGCCCCGTCACGGCGGTTGGCGCTCAGGGAATGTTCGCCATGGCGCCGCCGCAGCCGCAGCCGAATTGCCGACTCGACCTCTCTCCGCCGGCGGGGTTGGAATTCGCGGTGAATGGTTACCGGCACATGCCGTTCACGGCGCTGCTGTTGCAGCCGGCGACGGCGGAGGATAATCAGAACGACGAGTCTCTCGGCGAACAATGA

Predicted protein sequences of Glyma10g06515

Limit To All Plant Sequences

>Glyma10g06515.1   sequence type=predicted peptide   gene model=Glyma10g06515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSQVVLHNNFETQPSVTVTTATNTESPPTAPPSLAVVKRPSTKDRHTKVNGRGRRIRMPPLCAARIFQLTRELGHRSDGETIEWLLRHAEPSIIAATGSGTVPAAPVSSVAPSAPSSEPMVACPVTAVGAQGMFAMAPPQPQPNCRLDLSPPAGLEFAVNGYRHMPFTALLLQPATAEDNQNDESLGEQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain