SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g06491

Feature Type:gene_model
Chromosome:Gm10
Start:5201143
stop:5201322
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36985AT Annotation by Michelle Graham. TAIR10: DVL family protein | chr2:15534943-15535104 REVERSE LENGTH=53 SoyBaseE_val: 2.00E-20ISS
GO:0042127GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF08137PFAM DVL family JGI ISS
UniRef100_D7LUG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: DVL20/RTFL1 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LUG0_ARALL SoyBaseE_val: 1.00E-10ISS
UniRef100_I1L8Z4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L8Z4_SOYBN SoyBaseE_val: 4.00E-24ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma10g06491 not represented in the dataset

Glyma10g06491 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g20685 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g057200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g06491.1   sequence type=CDS   gene model=Glyma10g06491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGCAGGAAAGCAACACAAGCCAAAGCAATCATCAGCAGCAGCAACAGCATCAAGTTTGTGATCCCTGCAAGTCTTTTGGCCAGAAGTGCAGCCATCTTGTGAAGAAGCAGCGAGCAAAATTCTACATTCTTCGCCGTTGCGTAGCCATGCTTCTGTGTTGGCATGAGCACTGA

>Glyma10g06491.1   sequence type=predicted peptide   gene model=Glyma10g06491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVQESNTSQSNHQQQQQHQVCDPCKSFGQKCSHLVKKQRAKFYILRRCVAMLLCWHEH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo