SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g06430

Feature Type:gene_model
Chromosome:Gm10
Start:5153374
stop:5155263
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g06430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G52970AT Annotation by Michelle Graham. TAIR10: thylakoid lumen 15.0 kDa protein | chr5:21479620-21481018 FORWARD LENGTH=223 SoyBaseE_val: 2.00E-102ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B6SNQ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Permeases of the major facilitator superfamily n=1 Tax=Zea mays RepID=B6SNQ8_MAIZE SoyBaseE_val: 6.00E-107ISS
UniRef100_C6TDU2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TDU2_SOYBN SoyBaseE_val: 8.00E-167ISS

Expression Patterns of Glyma10g06430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g06430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g056700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g06430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g06430
>Glyma10g06430.2   sequence type=CDS   gene model=Glyma10g06430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGATGGCTCATTCTCATTATCTTCTTCACATTCCATCGTTATCATCTTTATCTGCATCTCTCACTTCCCCGCCTCGCTCGCTTCTTCCTGTTCGGACATTACAACCTAAGACGCTGTCGTGTCGTGTCCCTTCATTTCCAACACGCACCCCGTGGCACTTCAAGCCTCTTCATTTTGCTCTCTCTGGGGCACTCTCACTTGGGTTATTATTCGGAGGAATTGGCGTGGCTGAGGCTGCAAAAGTTGGTGTGAACAAGCCAGAGTTGCTCCCCAAGGAGTTTAGTACTGTCATTGATGTTGCTGGGTTCCTATCCGATGGACAGGAGAAAAGACTAGCAGAAGAGATTGCTGCTCTTGAAGCGGATACTGGATTCAAGTTAAGAGTTTTGGCCCAGAACTATCCTGTTACGCCAGGTTTGGCTATTAAAGATTTCTGGCAAGTAGATGACAGAACAGTTGTTTTTGTTGCTGATCCCACATTTGGCAATATATTGAATTTCAATGTTGGTGCTACGGTTGATTTGGATGTCCCACGTAGCTTTTGGAATCGCTTGGCTGGGAAGTATGGGAACATTTTCTATTGGAAAGAAAAGGGGGAAGATGCATCTATTGAAGCAGCAGTTATGGCAATTTCTAGTTGCTTGAGAGAACCAGTTGGGCCTAATAATTGTTCTGAGGTGAATTAA
Predicted protein sequences of Glyma10g06430
>Glyma10g06430.2   sequence type=predicted peptide   gene model=Glyma10g06430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMMAHSHYLLHIPSLSSLSASLTSPPRSLLPVRTLQPKTLSCRVPSFPTRTPWHFKPLHFALSGALSLGLLFGGIGVAEAAKVGVNKPELLPKEFSTVIDVAGFLSDGQEKRLAEEIAALEADTGFKLRVLAQNYPVTPGLAIKDFWQVDDRTVVFVADPTFGNILNFNVGATVDLDVPRSFWNRLAGKYGNIFYWKEKGEDASIEAAVMAISSCLREPVGPNNCSEVN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo