Report for Sequence Feature Glyma10g05950
Feature Type: gene_model
Chromosome: Gm10
Start: 4678248
stop: 4679436
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma10g05950
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_UPI000233C39D UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233C39D related cluster n=1 Tax=unknown RepID=UPI000233C39D
SoyBase E_val: 8.00E-29 ISS
Expression Patterns of Glyma10g05950
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma10g05950 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.10g052300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma10g05950
Coding sequences of Glyma10g05950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma10g05950.1 sequence type=CDS gene model=Glyma10g05950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTTGATTTGGTGATCCCTTCTCCCTGTATTCTGATTTATCAGATTTTGCCGTTCGTTTCTACTTTTCATTGGCCTGTGTTCGGAATAGTTTCGTGTAATGTTCTGCGTAGTGTGAAGCCGCCTCGAAAATGGGAAGATAAGCAACGGATGTGA
Predicted protein sequences of Glyma10g05950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma10g05950.1 sequence type=predicted peptide gene model=Glyma10g05950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLDLVIPSPCILIYQILPFVSTFHWPVFGIVSCNVLRSVKPPRKWEDKQRM*