SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g05790

Feature Type:gene_model
Chromosome:Gm10
Start:4533715
stop:4536335
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37120AT Annotation by Michelle Graham. TAIR10: S1FA-like DNA-binding protein | chr2:15594250-15594815 REVERSE LENGTH=76 SoyBaseE_val: 2.00E-14ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PF04689PFAM DNA binding protein S1FA JGI ISS
UniRef100_B9SGP8UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA-binding protein S1FA, putative n=1 Tax=Ricinus communis RepID=B9SGP8_RICCO SoyBaseE_val: 2.00E-24ISS
UniRef100_C6SZW9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZW9_SOYBN SoyBaseE_val: 1.00E-50ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g20160 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g050700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g05790.1   sequence type=CDS   gene model=Glyma10g05790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGACGACTTCGAATTCGCCGACAAAGTCCCTCCTTCCTTCGATCGCGCGGGTTCAAAAGGGTTCAACCCAGCTTTAATTGTTCTCCTGCTTGTTGGTGGGTTGCTGTTGACATTCCTCATTGGAAACTATGTACTCTACACATATGCACAGAAGACCCTCCCTCCTAGAAAAAAGAAGCCAGTCTCAAAGAAGAAGATGAAAAAGGAGAGACTGAAGCAGGGCGTCTCTGCACCTGGAGAGTAG

>Glyma10g05790.1   sequence type=predicted peptide   gene model=Glyma10g05790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADDFEFADKVPPSFDRAGSKGFNPALIVLLLVGGLLLTFLIGNYVLYTYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo