Glyma10g05790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g05790

Feature Type:	gene_model
Chromosome:	Gm10
Start:	4533715
stop:	4536335
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g05790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G37120	AT	Annotation by Michelle Graham. TAIR10: S1FA-like DNA-binding protein \| chr2:15594250-15594815 REVERSE LENGTH=76	SoyBase	E_val: 2.00E-14	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
PF04689	PFAM	DNA binding protein S1FA	JGI		ISS
UniRef100_B9SGP8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-binding protein S1FA, putative n=1 Tax=Ricinus communis RepID=B9SGP8_RICCO	SoyBase	E_val: 2.00E-24	ISS
UniRef100_C6SZW9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZW9_SOYBN	SoyBase	E_val: 1.00E-50	ISS

Expression Patterns of Glyma10g05790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g05790

Paralog	Evidence	Comments
Glyma13g20160	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g05790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g050700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g05790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g05790

Limit To All Plant Sequences

>Glyma10g05790.1   sequence type=CDS   gene model=Glyma10g05790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGACGACTTCGAATTCGCCGACAAAGTCCCTCCTTCCTTCGATCGCGCGGGTTCAAAAGGGTTCAACCCAGCTTTAATTGTTCTCCTGCTTGTTGGTGGGTTGCTGTTGACATTCCTCATTGGAAACTATGTACTCTACACATATGCACAGAAGACCCTCCCTCCTAGAAAAAAGAAGCCAGTCTCAAAGAAGAAGATGAAAAAGGAGAGACTGAAGCAGGGCGTCTCTGCACCTGGAGAGTAG

Predicted protein sequences of Glyma10g05790

Limit To All Plant Sequences

>Glyma10g05790.1   sequence type=predicted peptide   gene model=Glyma10g05790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADDFEFADKVPPSFDRAGSKGFNPALIVLLLVGGLLLTFLIGNYVLYTYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain