SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g05710

Feature Type:gene_model
Chromosome:Gm10
Start:4471860
stop:4476036
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g05710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G35795AT Annotation by Michelle Graham. TAIR10: Chaperone DnaJ-domain superfamily protein | chr2:15042321-15043334 FORWARD LENGTH=112 SoyBaseE_val: 7.00E-59ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
KOG0723 KOG Molecular chaperone (DnaJ superfamily) JGI ISS
PTHR12763Panther UNCHARACTERIZED JGI ISS
PTHR12763:SF4Panther UNCHARACTERIZED JGI ISS
PF00226PFAM DnaJ domain JGI ISS
UniRef100_B6TQ49UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit TIM14 n=1 Tax=Zea mays RepID=B6TQ49_MAIZE SoyBaseE_val: 2.00E-58ISS
UniRef100_C6TLK5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TLK5_SOYBN SoyBaseE_val: 1.00E-73ISS

Expression Patterns of Glyma10g05710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g05710
ParalogEvidenceComments
Glyma13g20060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g05710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g049900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g05710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g05710
>Glyma10g05710.1   sequence type=CDS   gene model=Glyma10g05710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACACCATTGGTGGCAGGGATTGCAGTGGCGGCTGCGGCTTATGCTGGTAGATATGGTATCCAGGCTTGGCAAGCATTCAAGGCTAGGCCACCGAGTATGCGAAAATTTTATGAAGGTGGTTTCCCGGCTACCATGACTAGGAGGGAAGCAGCTCTTATACTGGGTGTTAGGGAACGCACTCCAACAGATAAGATTAAAGAAGCACATAGGAGGGTGATGGTTGCAAACCATCCAGATGCAGGTGGCAGCCATTACCTTGCATCCAAAATTAATGAGGCAAAAGATATGTTAATTGGAAAGACCAAAGGTGGTGGGTCAGCATTTTGA
Predicted protein sequences of Glyma10g05710
>Glyma10g05710.1   sequence type=predicted peptide   gene model=Glyma10g05710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATPLVAGIAVAAAAYAGRYGIQAWQAFKARPPSMRKFYEGGFPATMTRREAALILGVRERTPTDKIKEAHRRVMVANHPDAGGSHYLASKINEAKDMLIGKTKGGGSAF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo