SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma10g05180

Feature Type:gene_model
Chromosome:Gm10
Start:4017373
stop:4017867
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37430AT Annotation by Michelle Graham. TAIR10: C2H2 and C2HC zinc fingers superfamily protein | chr2:15706454-15706990 FORWARD LENGTH=178 SoyBaseE_val: 3.00E-42ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR26374Panther FAMILY NOT NAMED JGI ISS
PTHR26374:SF459Panther JGI ISS
UniRef100_G7L0M5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Medicago truncatula RepID=G7L0M5_MEDTR SoyBaseE_val: 1.00E-58ISS
UniRef100_I1L8M2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L8M2_SOYBN SoyBaseE_val: 1.00E-110ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g19550 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g045200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma10g05180.1   sequence type=CDS   gene model=Glyma10g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGACAGAGAGATGGAGTAGAGAGCATAGATTTAGTAAATTGTCTAATGTTGCTCTCTCATCACAGAGAAATCAAACCCCAAAAACTTCTGGGCCCTGAAGAATTTGAGTGTATGACATGCAACCGGAAGTTCACTTCGTTTCAGGCCCTCGGAGGCCATAGGGCAAGCCACAAAAAGCCCAAATTACACGTAAAAGAACAGGGCAAAATTCTGATGTTGGGGAATAAGCCCAAAAAACACGAATGCACCATTTGTGGTAGGGAATTCACTTTGGGCCAGGCACTTGGAGGACACATGAAAAAACACAGAATTGCCGTTGACCAAGGGTTTTCTTTGATAAACGAGGTTGTTGTAAAAGTACCGTTTCTTAAAAGGTCTAATAGTAAGAGGGTTTTGTTCTTGGACTTGAACTTGAACTTGACTCCTCTGCAGAATGACTTGAAGTTATTATTTGGAGAAAAGGCACCCAAAGTTGATTCCTTCGTTTGA

>Glyma10g05180.1   sequence type=predicted peptide   gene model=Glyma10g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRQRDGVESIDLVNCLMLLSHHREIKPQKLLGPEEFECMTCNRKFTSFQALGGHRASHKKPKLHVKEQGKILMLGNKPKKHECTICGREFTLGQALGGHMKKHRIAVDQGFSLINEVVVKVPFLKRSNSKRVLFLDLNLNLTPLQNDLKLLFGEKAPKVDSFV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo